2D89 - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE CH DOMAIN FROM HUMAN EH DOMAIN BINDING PROTEIN 1

Authors :   T. Tomizawa, T. Kigawa, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   02 Dec 05 (Deposition) - 02 Jun 06 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   All Alpha, Calponin Homology Domain, Actin Binding, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Protein, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Tomizawa, T. Kigawa, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of The Ch Domain From Human Eh Domain Binding Protein 1
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - EHBP1 PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P050725-07
	Expression System Vector Type	:	PLASMID
	Fragment	:	CH DOMAIN
	Gene	:	EHBP1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	EH DOMAIN BINDING PROTEIN 1


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2D89)

(no "Site" information available for 2D89)

(no "SS Bond" information available for 2D89)

(no "Cis Peptide Bond" information available for 2D89)

(no "SAP(SNP)/Variant" information available for 2D89)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CH	PS50021	Calponin homology domain profile.	EHBP1_HUMAN	443-545	1	A:9-110

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3b	ENST00000263991	3b	ENSE00001270580	chr2:62933001-62933187	187	EHBP1_HUMAN	-	0	0	-	-
1.5b	ENST00000263991	5b	ENSE00002142414	chr2:62934032-62934430	399	EHBP1_HUMAN	1-35	35	0	-	-
1.6	ENST00000263991	6	ENSE00001651185	chr2:62974530-62974587	58	EHBP1_HUMAN	35-54	20	0	-	-
1.7b	ENST00000263991	7b	ENSE00001610459	chr2:62991401-62991496	96	EHBP1_HUMAN	55-86	32	0	-	-
1.8a	ENST00000263991	8a	ENSE00001746644	chr2:62998474-62998527	54	EHBP1_HUMAN	87-104	18	0	-	-
1.9c	ENST00000263991	9c	ENSE00001639652	chr2:63053222-63053403	182	EHBP1_HUMAN	105-165	61	0	-	-
1.10	ENST00000263991	10	ENSE00000962865	chr2:63058154-63058293	140	EHBP1_HUMAN	165-212	48	0	-	-
1.11b	ENST00000263991	11b	ENSE00001270570	chr2:63085541-63085645	105	EHBP1_HUMAN	212-247	36	0	-	-
1.12	ENST00000263991	12	ENSE00000443426	chr2:63086304-63086426	123	EHBP1_HUMAN	247-288	42	0	-	-
1.13b	ENST00000263991	13b	ENSE00001476087	chr2:63091866-63092106	241	EHBP1_HUMAN	288-368	81	0	-	-
1.15	ENST00000263991	15	ENSE00001270708	chr2:63101481-63101667	187	EHBP1_HUMAN	368-430	63	1	A:1-8	8
1.17	ENST00000263991	17	ENSE00001270698	chr2:63169853-63170031	179	EHBP1_HUMAN	431-490	60	1	A:9-55	47
1.18	ENST00000263991	18	ENSE00000810128	chr2:63170937-63170985	49	EHBP1_HUMAN	490-506	17	1	A:55-71	17
1.19b	ENST00000263991	19b	ENSE00001270679	chr2:63175395-63176297	903	EHBP1_HUMAN	507-807	301	1	A:72-119 (gaps)	159
1.20a	ENST00000263991	20a	ENSE00000810130	chr2:63182652-63182795	144	EHBP1_HUMAN	808-855	48	0	-	-
1.22b	ENST00000263991	22b	ENSE00000810131	chr2:63206323-63206470	148	EHBP1_HUMAN	856-905	50	0	-	-
1.23b	ENST00000263991	23b	ENSE00001270654	chr2:63215066-63215173	108	EHBP1_HUMAN	905-941	37	0	-	-
1.24	ENST00000263991	24	ENSE00001270645	chr2:63217851-63217975	125	EHBP1_HUMAN	941-982	42	0	-	-
1.25	ENST00000263991	25	ENSE00000810134	chr2:63220665-63220803	139	EHBP1_HUMAN	983-1029	47	0	-	-
1.26b	ENST00000263991	26b	ENSE00001155573	chr2:63221006-63221112	107	EHBP1_HUMAN	1029-1064	36	0	-	-
1.27	ENST00000263991	27	ENSE00000810136	chr2:63223778-63223901	124	EHBP1_HUMAN	1065-1106	42	0	-	-
1.28	ENST00000263991	28	ENSE00001270612	chr2:63264670-63264769	100	EHBP1_HUMAN	1106-1139	34	0	-	-
1.29	ENST00000263991	29	ENSE00001270602	chr2:63265878-63265951	74	EHBP1_HUMAN	1139-1164	26	0	-	-
1.30b	ENST00000263991	30b	ENSE00000757989	chr2:63272201-63272315	115	EHBP1_HUMAN	1164-1202	39	0	-	-
1.31f	ENST00000263991	31f	ENSE00001547495	chr2:63272545-63273622	1078	EHBP1_HUMAN	1202-1231	30	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:119
 aligned with EHBP1_HUMAN | Q8NDI1 from UniProtKB/Swiss-Prot  Length:1231

    Alignment length:244
                                   431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661    
          EHBP1_HUMAN   422 GKDLSTSPKPSPIPSPVLGRKPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELSDLKREPELQQPISGAVDFLSQDDSVFVNDSGVGESESEHQTPDDHLSPSTASPYCRRTKSDTEPQKSQQSSGRTSG 665
               SCOP domains d2d89a_               A: automated matches                                                                                                                                                                                                           SCOP domains
               CATH domains --2d89A0              1 A:3-114 Actin-binding Protein, T-fimbrin; domain 1                                                                                                                                                                     ----- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........--------------.hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh....hhhhh....hhhhhhhhhhhhh........hhhhhhhh...hhhhhhhhhhhhhhhhh---------------------------------------------------------------------------------------------------------------...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------CH  PDB: A:9-110 UniProt: 443-545                                                                      ------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.15Exon 1.17  PDB: A:9-55 UniProt: 431-490 [INCOMPLETE]        ----------------Exon 1.19b  PDB: A:72-119 (gaps) UniProt: 507-807 [INCOMPLETE]                                                                                                  Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------Exon 1.18        --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2d89 A   1 GSSGSSGP--------------NASQSLLVWCKEVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFS---------------------------------------------------------------------------------------------------------------SGPSSG 119
                                   | -         -  |     16        26        36        46        56        66        76        86        96       106      |  -         -         -         -         -         -         -         -         -         -         -       115    
                                   8              9                                                                                                     113                                                                                                             114

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: CH domain-like (55)

Superfamily: Calponin-homology domain, CH-domain (53)

Family: automated matches (25)

Protein domain: automated matches (25)

Human (Homo sapiens) [TaxId: 9606] (23)

d2d89a_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Actin-binding Protein, T-fimbrin; domain 1 (51)

Homologous Superfamily: Actin-binding Protein, T-fimbrin; domain 1 (51)

Human (Homo sapiens) (39)

2d89A01

A:3-114

(no "Pfam Domain" information available for 2D89)

NMR Structure(hide GO term definitions)

Chain A (EHBP1_HUMAN | Q8NDI1)


GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2d89)

	Sites
(no "Sites" information available for 2d89)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2d89)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2d89
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EHBP1_HUMAN \| Q8NDI1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	EHBP1_HUMAN \| Q8NDI1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2D89)

(no "Related Entries Specified in the PDB File" available for 2D89)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File