Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TRIVALENT RECOGNITION UNIT OF INNATE IMMUNITY SYSTEM; CRYSTAL STRUCTURE OF HUMAN M-FICOLIN FIBRINOGEN-LIKE DOMAIN
 
Authors :  M. Tanio, S. Kondo, S. Sugio, T. Kohno
Date :  26 Sep 05  (Deposition) - 12 Dec 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Innate Immunity System, Ficolin, M-Ficolin, Lectin Pathway, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Tanio, S. Kondo, S. Sugio, T. Kohno
Trivalent Recognition Unit Of Innate Immunity System; Crystal Structure Of Trimeric Human M-Ficolin Fibrinogen-Like Domain
J. Biol. Chem. V. 282 3889 2007
PubMed-ID: 17148457  |  Reference-DOI: 10.1074/JBC.M608627200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FICOLIN-1
    ChainsA, B, C
    EngineeredYES
    Expression SystemPICHIA PASTORIS
    Expression System PlasmidPPICZALPHA
    Expression System StrainX-33
    Expression System Taxid4922
    Expression System Vector TypePLASMID
    FragmentFIBRINOGEN LIKE DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCOLLAGEN/FIBRINOGEN DOMAIN-CONTAINING PROTEIN 1, FICOLIN-A, FICOLIN A, M-FICOLIN

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:262 , ASP A:264 , SER A:266 , SER A:268 , HOH A:1402 , HOH A:1403BINDING SITE FOR RESIDUE CA A 1401
2AC2SOFTWAREGLY B:250 , ASP C:262 , ASP C:264 , SER C:266 , SER C:268 , HOH C:2402BINDING SITE FOR RESIDUE CA C 2401

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:118 -A:146
2A:270 -A:283
3B:118 -B:146
4B:270 -B:283
5C:118 -C:146
6C:270 -C:283

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2D39)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 6)

Asymmetric/Biological Unit (2, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_024450Y126HFCN1_HUMANPolymorphism17549179A/B/CY126H
2UniProtVAR_036341Y175CFCN1_HUMANUnclassified  ---A/B/CY175C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 3)

Asymmetric/Biological Unit (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FIBRINOGEN_C_1PS00514 Fibrinogen C-terminal domain signature.FCN1_HUMAN278-290
 
 
  3A:278-290
B:278-290
C:278-290

(-) Exons   (5, 14)

Asymmetric/Biological Unit (5, 14)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003718061ENSE00001096640chr9:137809809-137809615195FCN1_HUMAN1-35350--
1.2ENST000003718062ENSE00000828380chr9:137808307-137808194114FCN1_HUMAN35-73390--
1.3ENST000003718063ENSE00000828382chr9:137806655-13780660254FCN1_HUMAN73-91190--
1.4ENST000003718064ENSE00000418292chr9:137806266-13780623136FCN1_HUMAN91-103130--
1.5ENST000003718065ENSE00000828385chr9:137805459-13780542733FCN1_HUMAN103-114122A:113-114
B:114-114
-
2
1
-
1.6ENST000003718066ENSE00001727220chr9:137804989-137804862128FCN1_HUMAN114-156433A:114-156
B:114-156
C:115-156
43
43
42
1.7bENST000003718067bENSE00002182807chr9:137804461-137804332130FCN1_HUMAN157-200443A:157-200
B:157-200
C:157-200
44
44
44
1.8ENST000003718068ENSE00001719849chr9:137803113-137802979135FCN1_HUMAN200-245463A:200-245
B:200-245
C:200-245
46
46
46
1.9bENST000003718069bENSE00001740230chr9:137801891-137801431461FCN1_HUMAN245-326823A:245-326 (gaps)
B:245-326 (gaps)
C:245-326
82
82
82

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:209
 aligned with FCN1_HUMAN | O00602 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:214
                                   122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322    
           FCN1_HUMAN   113 TGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 326
               SCOP domains d2d39a_ A: automated matches                                                                                                                                                                                           SCOP domains
               CATH domains 2d39A01 A:113-244,A:318-326 Gamma Fibrinogen, chain A, domain 1                                                                     2d39A02 A:245-317 Gamma-fibrinogen Carboxyl Termina     l Fragment, domai2d39A01   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhh.....eeeeee.....eeeeeee.hhhhh.eeeeeee.........hhhhhhhhee.....ee.hhhhhhhhhhh..eeeeeeee.....eeeeee..eee.hhhhh..eee..eee...........................hhhhhh.....................-----...ee.........ee.eeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------H------------------------------------------------C------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_------------------------------------ PROSITE
           Transcript 1 (1) 1.------------------------------------------Exon 1.7b  PDB: A:157-200 UniProt: 157-200  --------------------------------------------Exon 1.9b  PDB: A:245-326 (gaps) UniProt: 245-326                                  Transcript 1 (1)
           Transcript 1 (2) -Exon 1.6  PDB: A:114-156 UniProt: 114-156  -------------------------------------------Exon 1.8  PDB: A:200-245 UniProt: 200-245     --------------------------------------------------------------------------------- Transcript 1 (2)
                 2d39 A 113 EFPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMG-----ANGINWSAAKGYKYSYKVSEMKVRPA 326
                                   122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292  |    302       312       322    
                                                                                                                                                                                                                295   301                         

Chain B from PDB  Type:PROTEIN  Length:200
 aligned with FCN1_HUMAN | O00602 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:213
                                   123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323   
           FCN1_HUMAN   114 GPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 326
               SCOP domains d2d39b_ B: automated matches                                                                                                                                                                                          SCOP domains
               CATH domains 2d39B01 B:114-244,B:318-326 Gamma Fibrinogen, chain A, domain 1                                                                    2d39B02 B:245-317 Gamma-fibrinogen Carboxyl Termi       nal Fra      gmen2d39B01   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh.....eeeeee.....eeeeeee.hhhhh.eeeeeee.........hhhhhhhhee.....ee.hhhhhhhhhh...eeeeeeee.....eeeeee..eee.hhhhh..eee..eee...........................hhhhhh...................-------...ee..------.ee.eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------H------------------------------------------------C------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_------------------------------------ PROSITE
           Transcript 1 (1) 1------------------------------------------Exon 1.7b  PDB: B:157-200 UniProt: 157-200  --------------------------------------------Exon 1.9b  PDB: B:245-326 (gaps) UniProt: 245-326                                  Transcript 1 (1)
           Transcript 1 (2) Exon 1.6  PDB: B:114-156 UniProt: 114-156  -------------------------------------------Exon 1.8  PDB: B:200-245 UniProt: 200-245     --------------------------------------------------------------------------------- Transcript 1 (2)
                 2d39 B 114 FPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYL-------ANGINWS------YSYKVSEMKVRPA 326
                                   123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303   |     -|      323   
                                                                                                                                                                                                             293     301   307    314            

Chain C from PDB  Type:PROTEIN  Length:212
 aligned with FCN1_HUMAN | O00602 from UniProtKB/Swiss-Prot  Length:326

    Alignment length:212
                                   124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324  
           FCN1_HUMAN   115 PRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 326
               SCOP domains d2d39c_ C: automated matches                                                                                                                                                                                         SCOP domains
               CATH domains 2d39C01 C:115-244,C:318-326 Gamma Fibrinogen, chain A, domain 1                                                                   2d39C02 C:245-317 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2  2d39C01   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh.....eeeeee.....eeeeeee.hhhhh.eeeeeee.........hhhhhhhhee.....ee.hhhhhhhhhh...eeeeeeee.....eeeeeeeeeee.hhhhh..eee................................hhhhhh.............................eeeeee..eeeee.eeeeeeee. Sec.struct. author
                 SAPs(SNPs) -----------H------------------------------------------------C------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_------------------------------------ PROSITE
           Transcript 1 (1) ------------------------------------------Exon 1.7b  PDB: C:157-200 UniProt: 157-200  --------------------------------------------Exon 1.9b  PDB: C:245-326 UniProt: 245-326                                         Transcript 1 (1)
           Transcript 1 (2) Exon 1.6  PDB: C:115-156 UniProt: 114-156 -------------------------------------------Exon 1.8  PDB: C:200-245 UniProt: 200-245     --------------------------------------------------------------------------------- Transcript 1 (2)
                 2d39 C 115 PRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 326
                                   124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2D39)

(-) Gene Ontology  (23, 23)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (FCN1_HUMAN | O00602)
molecular function
    GO:0001664    G-protein coupled receptor binding    Interacting selectively and non-covalently with a G-protein coupled receptor.
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0033691    sialic acid binding    Interacting selectively and non-covalently with sialic acid, any of a variety of N- or O- substituted derivatives of neuraminic acid, a nine carbon monosaccharide. Sialic acids often occur in polysaccharides, glycoproteins, and glycolipids in animals and bacteria.
    GO:0008329    signaling pattern recognition receptor activity    Combining with a pathogen-associated molecular pattern (PAMP), a structure conserved among microbial species, or damage-associated molecular pattern (DAMP), an endogenous molecule released from damaged cells), and transmitting a signal to initiate a change in cell activity.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0002752    cell surface pattern recognition receptor signaling pathway    Any series of molecular signals generated as a consequence of a cell surface pattern recognition receptor (PRR) binding to one of its physiological ligands. PRRs bind pathogen-associated molecular pattern (PAMPs), structures conserved among microbial species, or damage-associated molecular pattern (DAMPs), endogenous molecules released from damaged cells.
    GO:0006956    complement activation    Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway.
    GO:0001867    complement activation, lectin pathway    Any process involved in the activation of any of the steps of the lectin pathway of the complement cascade which allows for the direct killing of microbes and the regulation of other immune processes.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0046597    negative regulation of viral entry into host cell    Any process that stops, prevents, or reduces the frequency, rate or extent of the entry of viral entry into a host cell.
    GO:2000484    positive regulation of interleukin-8 secretion    Any process that activates or increases the frequency, rate or extent of interleukin-8 secretion.
    GO:0034394    protein localization to cell surface    A process in which a protein is transported to, or maintained in, a location within the external part of the cell wall and/or plasma membrane.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0043654    recognition of apoptotic cell    The process in which a cell interprets signals (in the form of specific proteins and lipids) on the surface of a dying cell which it will engulf and remove by phagocytosis.
cellular component
    GO:0005581    collagen trimer    A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0031232    extrinsic component of external side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its external surface, but not integrated into the hydrophobic region.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2d39)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2d39
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FCN1_HUMAN | O00602
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FCN1_HUMAN | O00602
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FCN1_HUMAN | O006022jhh 2jhi 2jhk 2jhl 2jhm 2wnp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2D39)