Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF THE CORTACTIN-SH3 DOMAIN AND AMAP1-PEPTIDE COMPLEX
 
Authors :  S. Hashimoto, M. Hirose, A. Hashimoto, M. Morishige, A. Yamada, H. Hosaka, K. Akagi, E. Ogawa, C. Oneyama, T. Agatsuma, M. Okada, H. Kobayashi, H. Wada, H. Nakano, T. Ikegami, A. Nakagawa, H. Sabe
Date :  01 Sep 05  (Deposition) - 25 Apr 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D,P,Q
Biol. Unit 1:  A,B,P  (1x)
Biol. Unit 2:  C,D,Q  (1x)
Keywords :  Sh3, Proline-Rich, Complex, Cell Invasion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Hashimoto, M. Hirose, A. Hashimoto, M. Morishige, A. Yamada, H. Hosaka, K. Akagi, E. Ogawa, C. Oneyama, T. Agatsuma, M. Okada, H. Kobayashi, H. Wada, H. Nakano, T. Ikegami, A. Nakagawa, H. Sabe
Targeting Amap1 And Cortactin Binding Bearing An Atypical Src Homology 3/Proline Interface For Prevention Of Breast Cancer Invasion And Metastasis.
Proc. Natl. Acad. Sci. Usa V. 103 7036 2006
PubMed-ID: 16636290  |  Reference-DOI: 10.1073/PNAS.0509166103
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CORTACTIN ISOFORM A
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPGEX6P-1
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentSH3 DOMAIN
    GeneCTTN(AMINO ACIDS 490-550)
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 2 - PROLINE RICH REGION FROM DEVELOPMENT AND DIFFERENTIATION ENHANCING FACTOR 1
    ChainsP, Q
    EngineeredYES
    Other DetailsTHIS SEQUENCE OCCURS NATURALLY IN HUMANS.
    SyntheticYES

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDPQ
Biological Unit 1 (1x)AB  P 
Biological Unit 2 (1x)  CD Q

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1SO42Ligand/IonSULFATE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH B:80 , LYS P:3 , ARG P:4BINDING SITE FOR RESIDUE SO4 P 1001
2AC2SOFTWARELYS Q:3 , ARG Q:4 , HOH Q:73BINDING SITE FOR RESIDUE SO4 Q 1002

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2D1X)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gly C:-4 -Pro C:-3

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2D1X)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH3PS50002 Src homology 3 (SH3) domain profile.SRC8_HUMAN492-550
 
 
 
  4A:3-61
B:3-61
C:3-61
D:3-61
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH3PS50002 Src homology 3 (SH3) domain profile.SRC8_HUMAN492-550
 
 
 
  2A:3-61
B:3-61
-
-
Biological Unit 2 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH3PS50002 Src homology 3 (SH3) domain profile.SRC8_HUMAN492-550
 
 
 
  2-
-
C:3-61
D:3-61

(-) Exons   (3, 9)

Asymmetric Unit (3, 9)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003018431bENSE00001330492chr11:70244612-70244720109SRC8_HUMAN-00--
1.2ENST000003018432ENSE00001119698chr11:70251371-7025146797SRC8_HUMAN-00--
1.3aENST000003018433aENSE00002157616chr11:70253404-7025349087SRC8_HUMAN1-29290--
1.4aENST000003018434aENSE00001064324chr11:70253624-7025369774SRC8_HUMAN30-54250--
1.5ENST000003018435ENSE00001064322chr11:70255937-70256066130SRC8_HUMAN54-97440--
1.7aENST000003018437aENSE00001064330chr11:70260648-70260758111SRC8_HUMAN98-134370--
1.8aENST000003018438aENSE00001064328chr11:70261769-7026182355SRC8_HUMAN135-153190--
1.9bENST000003018439bENSE00001064327chr11:70263119-70263229111SRC8_HUMAN153-190380--
1.10bENST0000030184310bENSE00001064326chr11:70265852-70265962111SRC8_HUMAN190-227380--
1.10gENST0000030184310gENSE00001064329chr11:70266506-70266616111SRC8_HUMAN227-264380--
1.11aENST0000030184311aENSE00001230269chr11:70267576-70267686111SRC8_HUMAN264-301380--
1.11fENST0000030184311fENSE00001119696chr11:70269046-7026910156SRC8_HUMAN301-319190--
1.12ENST0000030184312ENSE00000737459chr11:70271438-7027150770SRC8_HUMAN320-343240--
1.13bENST0000030184313bENSE00002141022chr11:70275157-70275305149SRC8_HUMAN343-392500--
1.14ENST0000030184314ENSE00000831428chr11:70277297-7027738690SRC8_HUMAN393-422300--
1.15ENST0000030184315ENSE00000831427chr11:70279207-70279384178SRC8_HUMAN423-482601-
-
C:-4-0 (gaps)
-
-
-
13
-
1.16bENST0000030184316bENSE00000831426chr11:70279753-7027982472SRC8_HUMAN482-506254A:2-17
B:3-17
C:1-17
D:3-17
16
15
17
15
1.17cENST0000030184317cENSE00001893938chr11:70281132-702826811550SRC8_HUMAN506-550454A:17-61
B:17-61
C:17-61
D:17-61
45
45
45
45

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:60
 aligned with SRC8_HUMAN | Q14247 from UniProtKB/Swiss-Prot  Length:550

    Alignment length:60
                                   500       510       520       530       540       550
           SRC8_HUMAN   491 NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ 550
               SCOP domains d2d1xa_ A: automated matches                                 SCOP domains
               CATH domains 2d1xA00 A:2-61 SH3 Domains                                   CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eee..................eeeeee.....eeeeee..eeeeee...eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -SH3  PDB: A:3-61 UniProt: 492-550                           PROSITE
           Transcript 1 (1) ---------------Exon 1.17c  PDB: A:17-61 UniProt: 506-550     Transcript 1 (1)
           Transcript 1 (2) Exon 1.16b      -------------------------------------------- Transcript 1 (2)
                 2d1x A   2 NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ  61
                                    11        21        31        41        51        61

Chain B from PDB  Type:PROTEIN  Length:59
 aligned with SRC8_HUMAN | Q14247 from UniProtKB/Swiss-Prot  Length:550

    Alignment length:59
                                   501       511       521       531       541         
           SRC8_HUMAN   492 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ 550
               SCOP domains d2d1xb_ B: automated matches                                SCOP domains
               CATH domains 2d1xB00 B:3-61 SH3 Domains                                  CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..................eeeeee.....eeeeee..eeeeee...eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE SH3  PDB: B:3-61 UniProt: 492-550                           PROSITE
           Transcript 1 (1) --------------Exon 1.17c  PDB: B:17-61 UniProt: 506-550     Transcript 1 (1)
           Transcript 1 (2) Exon 1.16b     -------------------------------------------- Transcript 1 (2)
                 2d1x B   3 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ  61
                                    12        22        32        42        52         

Chain C from PDB  Type:PROTEIN  Length:66
 aligned with SRC8_HUMAN | Q14247 from UniProtKB/Swiss-Prot  Length:550

    Alignment length:116
                                   444       454       464       474       484       494       504       514       524       534       544      
           SRC8_HUMAN   435 GPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ 550
               SCOP domains d2d1        x                                          c_ C: automated matches                                       SCOP domains
               CATH domains 2d1x        C                                          00 C:-4-61 SH3 Domains                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....--------.------------------------------------------.......eee..................eeeeeee....eeeeee..eeeeee...eee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------SH3  PDB: C:3-61 UniProt: 492-550                           PROSITE
           Transcript 1 (1) Exon 1.15  PDB: C:-4-0 (gaps) UniProt: 423-482  -----------------------Exon 1.17c  PDB: C:17-61 UniProt: 506-550     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.16b  PDB: C:1-17  -------------------------------------------- Transcript 1 (2)
                 2d1x C  -4 GPLG--------S------------------------------------------ENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ  61
                               |     -  |      -         -         -         -     |   5        15        25        35        45        55      
                              -1        0                                          1                                                            

Chain D from PDB  Type:PROTEIN  Length:59
 aligned with SRC8_HUMAN | Q14247 from UniProtKB/Swiss-Prot  Length:550

    Alignment length:59
                                   501       511       521       531       541         
           SRC8_HUMAN   492 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ 550
               SCOP domains d2d1xd_ D: automated matches                                SCOP domains
               CATH domains 2d1xD00 D:3-61 SH3 Domains                                  CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..................eeeeee.....eeeeee..eeeeee...eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE SH3  PDB: D:3-61 UniProt: 492-550                           PROSITE
           Transcript 1 (1) --------------Exon 1.17c  PDB: D:17-61 UniProt: 506-550     Transcript 1 (1)
           Transcript 1 (2) Exon 1.16b     -------------------------------------------- Transcript 1 (2)
                 2d1x D   3 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ  61
                                    12        22        32        42        52         

Chain P from PDB  Type:PROTEIN  Length:9
 aligned with ASAP1_HUMAN | Q9ULH1 from UniProtKB/Swiss-Prot  Length:1129

    Alignment length:9
          ASAP1_HUMAN   825 KRPPPPPPG 833
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 2d1x P   3 KRPPPPPPG  11

Chain Q from PDB  Type:PROTEIN  Length:9
 aligned with ASAP1_HUMAN | Q9ULH1 from UniProtKB/Swiss-Prot  Length:1129

    Alignment length:9
          ASAP1_HUMAN   825 KRPPPPPPG 833
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 2d1x Q   3 KRPPPPPPG  11

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2D1X)

(-) Gene Ontology  (49, 53)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (SRC8_HUMAN | Q14247)
molecular function
    GO:0005522    profilin binding    Interacting selectively and non-covalently with profilin, an actin-binding protein that forms a complex with G-actin and prevents it from polymerizing to form F-actin.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0031532    actin cytoskeleton reorganization    A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of constituent parts of cytoskeletal structures comprising actin filaments and their associated proteins.
    GO:0030041    actin filament polymerization    Assembly of actin filaments by the addition of actin monomers to a filament.
    GO:0048870    cell motility    Any process involved in the controlled self-propelled movement of a cell that results in translocation of the cell from one place to another.
    GO:0097062    dendritic spine maintenance    The organization process that preserves a dendritic spine in a stable functional or structural state. A dendritic spine is a specialized protrusion from a neuronal dendrite and is involved in synaptic transmission.
    GO:0006897    endocytosis    A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
    GO:0048041    focal adhesion assembly    The aggregation and bonding together of a set of components to form a focal adhesion, a complex of intracellular signaling and structural proteins that provides a structural link between the internal actin cytoskeleton and the ECM, and also function as a locus of signal transduction activity.
    GO:0006886    intracellular protein transport    The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
    GO:0097581    lamellipodium organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a lamellipodium. A lamellipodium is a thin sheetlike process extended by the leading edge of a crawling fibroblast; contains a dense meshwork of actin filaments.
    GO:2001237    negative regulation of extrinsic apoptotic signaling pathway    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
    GO:0048812    neuron projection morphogenesis    The process in which the anatomical structures of a neuron projection are generated and organized. A neuron projection is any process extending from a neural cell, such as axons or dendrites.
    GO:0030838    positive regulation of actin filament polymerization    Any process that activates or increases the frequency, rate or extent of actin polymerization.
    GO:0045987    positive regulation of smooth muscle contraction    Any process that activates or increases the frequency, rate or extent of smooth muscle contraction.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
    GO:0030516    regulation of axon extension    Any process that modulates the rate, direction or extent of axon extension.
    GO:1903146    regulation of mitophagy    Any process that modulates the frequency, rate or extent of mitochondrion degradation (mitophagy).
    GO:0006930    substrate-dependent cell migration, cell extension    The formation of a cell surface protrusion, such as a lamellipodium or filopodium, at the leading edge of a migrating cell.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005884    actin filament    A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
    GO:0005938    cell cortex    The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0005905    clathrin-coated pit    A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
    GO:0030863    cortical cytoskeleton    The portion of the cytoskeleton that lies just beneath the plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0043197    dendritic spine    A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0030426    growth cone    The migrating motile tip of a growing nerve cell axon or dendrite.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0030027    lamellipodium    A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:1990023    mitotic spindle midzone    The area in the center of the anaphase spindle consisting of microtubules, microtubule bundling factors and kinesin motors where the spindle microtubules from opposite poles overlap in an antiparallel manner.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0002102    podosome    An actin-rich adhesion structure characterized by formation upon cell substrate contact and localization at the substrate-attached part of the cell, contain an F-actin-rich core surrounded by a ring structure containing proteins such as vinculin and talin, and have a diameter of 0.5 mm.
    GO:0001726    ruffle    Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

Chain P,Q   (ASAP1_HUMAN | Q9ULH1)
molecular function
    GO:0005096    GTPase activator activity    Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005547    phosphatidylinositol-3,4,5-trisphosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-3,4,5-trisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3', 4' and 5' positions.
    GO:0005546    phosphatidylinositol-4,5-bisphosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-4,5-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 4' and 5' positions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0030030    cell projection organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0060271    cilium assembly    The assembly of a cilium, a specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface. Each cilium is bounded by an extrusion of the cytoplasmic membrane, and contains a regular longitudinal array of microtubules, anchored basally in a centriole.
    GO:0061000    negative regulation of dendritic spine development    Any process that decreases the rate, frequency, or extent of dendritic spine development, the process whose specific outcome is the progression of the dendritic spine over time, from its formation to the mature structure.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0043197    dendritic spine    A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly C:-4 - Pro C:-3   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2d1x
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ASAP1_HUMAN | Q9ULH1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SRC8_HUMAN | Q14247
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ASAP1_HUMAN | Q9ULH1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SRC8_HUMAN | Q14247
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ASAP1_HUMAN | Q9ULH12da0 2ed1 2rqt 2rqu
        SRC8_HUMAN | Q142471x69

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2D1X)