2CPE - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE RNA RECOGNITION MOTIF OF EWING SARCOMA(EWS) PROTEIN

Authors :   T. Nagata, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   19 May 05 (Deposition) - 19 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Rna Recognition Motif, Rrm, Rnp, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Oncoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Nagata, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama
Solution Structure Of The Rna Recognition Motif Of Ewing Sarcoma(Ews) Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - RNA-BINDING PROTEIN EWS
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P040329-86
	Expression System Vector Type	:	PLASMID
	Fragment	:	RNA RECOGNITION MOTIF
	Gene	:	EWSR1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	EWS ONCOGENE, EWING SARCOMA BREAKPOINT REGION 1 PROTEIN


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2CPE)

(no "Site" information available for 2CPE)

(no "SS Bond" information available for 2CPE)

(no "Cis Peptide Bond" information available for 2CPE)

(no "SAP(SNP)/Variant" information available for 2CPE)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	EWS_HUMAN	361-447	1	A:361-447

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000397938	1b	ENSE00001884360	chr22:29664007-29664338	332	EWS_HUMAN	1-5	5	0	-	-
1.3	ENST00000397938	3	ENSE00001301837	chr22:29668205-29668241	37	EWS_HUMAN	5-17	13	0	-	-
1.4a	ENST00000397938	4a	ENSE00001326177	chr22:29668369-29668420	52	EWS_HUMAN	17-34	18	0	-	-
1.5c	ENST00000397938	5c	ENSE00001310992	chr22:29669730-29669853	124	EWS_HUMAN	35-76	42	0	-	-
1.7c	ENST00000397938	7c	ENSE00001297760	chr22:29674019-29674205	187	EWS_HUMAN	76-138	63	0	-	-
1.8c	ENST00000397938	8c	ENSE00002164144	chr22:29678379-29678546	168	EWS_HUMAN	138-194	57	0	-	-
1.9c	ENST00000397938	9c	ENSE00002186154	chr22:29682912-29683123	212	EWS_HUMAN	194-265	72	0	-	-
1.10d	ENST00000397938	10d	ENSE00001787873	chr22:29684595-29684775	181	EWS_HUMAN	265-325	61	1	A:346-346	1
1.10k	ENST00000397938	10k	ENSE00001300293	chr22:29687551-29687588	38	EWS_HUMAN	325-338	14	1	A:346-352	7
1.10n	ENST00000397938	10n	ENSE00001645450	chr22:29688126-29688158	33	EWS_HUMAN	338-349	12	0	-	-
1.11a	ENST00000397938	11a	ENSE00001803203	chr22:29688477-29688595	119	EWS_HUMAN	349-388	40	1	A:353-388	36
1.12b	ENST00000397938	12b	ENSE00001668989	chr22:29692229-29692358	130	EWS_HUMAN	389-432	44	1	A:389-432	44
1.13	ENST00000397938	13	ENSE00001774808	chr22:29693817-29693939	123	EWS_HUMAN	432-473	42	1	A:432-454	23
1.14a	ENST00000397938	14a	ENSE00001666604	chr22:29694723-29694885	163	EWS_HUMAN	473-527	55	1	A:455-458	4
1.14e	ENST00000397938	14e	ENSE00001785831	chr22:29695224-29695321	98	EWS_HUMAN	527-560	34	0	-	-
1.14f	ENST00000397938	14f	ENSE00001689746	chr22:29695589-29695841	253	EWS_HUMAN	560-644	85	0	-	-
1.15d	ENST00000397938	15d	ENSE00001530851	chr22:29696112-29696515	404	EWS_HUMAN	644-656	13	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with EWS_HUMAN | Q01844 from UniProtKB/Swiss-Prot  Length:656

    Alignment length:188
                                   334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504        
            EWS_HUMAN   325 GSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGG 512
               SCOP domains ----------------------------d2cpea1 A:353-453 RNA-binding protein EWS                                                            ----------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......---------------------.........eeeee.......hhhhh...................eee...........eeeee...hhhhhhhhhhh..........eee...........------------------------------------------------------.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------RRM  PDB: A:361-447 UniProt: 361-447                                                   ----------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1------------Exon 1.10n  ---------------------------------------Exon 1.12b  PDB: A:389-432 UniProt: 389-432 ----------------------------------------Exon 1.14a  PDB: A:455-458 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) Exon 1.10k    ----------Exon 1.11a  PDB: A:353-388 [INCOMPLETE] -------------------------------------------Exon 1.13  PDB: A:432-454 UniProt: 432-473--------------------------------------- Transcript 1 (2)
                 2cpe A 346 GSSGSSG---------------------DPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSG------------------------------------------------------PSSG 458
                                  |  -         -       354       364       374       384       394       404       414       424       434       444       454         -         -         -         -         -    |   
                                352                   353                                                                                                  454                                                    455

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: RNA-binding domain, RBD (289)

Family: Canonical RBD (214)

Protein domain: RNA-binding protein EWS (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d2cpea1

A:353-453

(no "CATH Domain" information available for 2CPE)

(no "Pfam Domain" information available for 2CPE)

NMR Structure(hide GO term definitions)

Chain A (EWS_HUMAN | Q01844)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2cpe)

	Sites
(no "Sites" information available for 2cpe)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cpe)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2cpe
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EWS_HUMAN \| Q01844
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	EWS_HUMAN \| Q01844
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2CPE)

(no "Related Entries Specified in the PDB File" available for 2CPE)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File