|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2CO5) |
Sites (0, 0)| (no "Site" information available for 2CO5) |
SS Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CO5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CO5) |
Exons (0, 0)| (no "Exon" information available for 2CO5) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:92 aligned with Q6Q0J9_9VIRU | Q6Q0J9 from UniProtKB/TrEMBL Length:93 Alignment length:92 93 14 24 34 44 54 64 74 84 |- Q6Q0J9_9VIRU 5 KYMRINYYIILKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVLFLTEKGMKEFEELHEFFKKIVC--- - SCOP domains d2co5a1 A:5-93 STIV F93 --- SCOP domains CATH domains -------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 2co5 A 5 KYMRINYYIILKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVLFLTEKGMKEFEELHEFFKKIVCHHH 96 14 24 34 44 54 64 74 84 94 Chain B from PDB Type:PROTEIN Length:94 aligned with Q6Q0J9_9VIRU | Q6Q0J9 from UniProtKB/TrEMBL Length:93 Alignment length:94 93 10 20 30 40 50 60 70 80 90 | Q6Q0J9_9VIRU 1 MKIRKYMRINYYIILKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVLFLTEKGMKEFEELHEFFKKIVC- - SCOP domains d2co5b_ B: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------- Transcript 2co5 B 1 MKIRKYMRINYYIILKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVLFLTEKGMKEFEELHEFFKKIVCH 94 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2CO5) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CO5) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2CO5)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|