|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 5)| Asymmetric Unit (5, 5) Biological Unit 1 (4, 24) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2CCV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CCV) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CCV) |
Exons (0, 0)| (no "Exon" information available for 2CCV) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:99 aligned with Q2F1K8_HELPO | Q2F1K8 from UniProtKB/TrEMBL Length:121 Alignment length:99 30 40 50 60 70 80 90 100 110 Q2F1K8_HELPO 21 RVQSGKIDCGNDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIE 119 SCOP domains d2ccva1 A:1-99 Agglutinin HPA SCOP domains CATH domains --------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2ccv A 1 RVQSGKIDCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPSGFKASCYTWHNTKVYSMSISWISIE 99 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2CCV) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CCV) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (Q2F1K8_HELPO | Q2F1K8)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|