2C9N | PD0938 - JenaLib

Title :   STRUCTURE OF THE EPSTEIN-BARR VIRUS ZEBRA PROTEIN AT APPROXIMATELY 3.5 ANGSTROM RESOLUTION

Authors :   C. Petosa, P. Morand, F. Baudin, M. Moulin, J. B. Artero, C. W. Muller

Date :   13 Dec 05 (Deposition) - 21 Feb 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.30

Chains :   Asym./Biol. Unit : A,B,Y,Z

Keywords :   Viral Protein, Epstein-Barr Virus, Ebv, Zebra, Bzlf1, Zta, Z, Lytic Cycle Activation, Bzip Protein, Viral Protein Dna-Binding, Nuclear Protein, Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Petosa, P. Morand, F. Baudin, M. Moulin, J. B. Artero, C. W. Muller
Structural Basis Of Lytic Cycle Activation By The Epstein-Barr Virus Zebra Protein
Mol. Cell V. 21 565 2006
PubMed-ID: 16483937 | Reference-DOI: 10.1016/J.MOLCEL.2006.01.006

Compounds

Molecule 1 - BZLF1 TRANS-ACTIVATOR PROTEIN
	Chains	:	Y, Z
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	DNA-BINDING AND DIMERIZATION DOMAIN, RESIDUES 175-236
	Organism Scientific	:	HUMAN HERPESVIRUS 4
	Organism Taxid	:	10376
	Synonym	:	EB1, ZEBRA

*Molecule 2 - 5'-D(CPAPCPTPGPAPCPTPCPAP T)-3'**
	Chains	:	A
	Organism Scientific	:	HUMAN HERPESVIRUS 4
	Organism Taxid	:	10376
	Synthetic	:	YES

*Molecule 3 - 5'-D(CPAPTPGPAPGPTPCPAPGP T)-3'**
	Chains	:	B
	Organism Scientific	:	HUMAN HERPESVIRUS 4
	Organism Taxid	:	10376
	Synthetic	:	YES

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:DNA  Length:11
                                           
                 2c9n A   4 CACTGACTCAT  14
                                    13

Chain B from PDB  Type:DNA  Length:11
                                           
                 2c9n B 106 CATGAGTCAGT 116
                                   115

Chain Y from PDB  Type:PROTEIN  Length:59
 aligned with BZLF1_EBVB9 | P03206 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:59
                                   187       197       207       217       227         
          BZLF1_EBVB9   178 KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD 236
               SCOP domains d2c9ny1 Y:178-236 Trans-activator protein BZLF1             SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE BZIP_BASIC     -------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                 2c9n Y 178 KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD 236
                                   187       197       207       217       227

Chain Z from PDB  Type:PROTEIN  Length:59
 aligned with BZLF1_EBVB9 | P03206 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:59
                                   187       197       207       217       227         
          BZLF1_EBVB9   178 KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD 236
               SCOP domains d2c9nz1 Z:178-236 Trans-activator protein BZLF1             SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE BZIP_BASIC     -------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                 2c9n Z 178 KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD 236
                                   187       197       207       217       227

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (15, 15)

Asymmetric/Biological Unit(hide GO term definitions)

Chain Y,Z (BZLF1_EBVB9 | P03206)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0039646	modulation by virus of host G0/G1 transition checkpoint	Any viral process that modulates the frequency, rate or extent of the host cell G0/G1 transition checkpoint.
	GO:0060153	modulation by virus of host cell cycle	Any viral process that modulates the rate or extent of progression through the cell cycle.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0039557	suppression by virus of host IRF7 activity	Any process in which a virus stops, prevents, or reduces the activity of host IRF7 (interferon regulatory factor-7), a transcription factor in the RIG-I/MDA-5 signaling pathway. Viral infection triggers phosphorylation of cytoplasmic IRF7, which allows IRF7 to form a homodimer, migrate to the nucleus, and activate transcription of IFN-alpha and IFN-beta genes.
	GO:0039503	suppression by virus of host innate immune response	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of the innate immune response of the host organism, the host's first line of defense.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0042025	host cell nucleus	A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2c9n)

	Sites
(no "Sites" information available for 2c9n)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2c9n)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2c9n
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BZLF1_EBVB9 \| P03206
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description