2BZE - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   NMR STRUCTURE OF HUMAN RTF1 PLUS3 DOMAIN.

Authors :   V. Truffault, T. Diercks, E. Ab, R. N. De Jong, M. A. Daniels, R. Kaptein G. E. Folkers, Structural Proteomics In Europe (Spine)

Date :   16 Aug 05 (Deposition) - 03 Jan 07 (Release) - 24 May 17 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (25x)
NMR Structure *: A  (1x)

Keywords :   Human Rtf1 Plus3 Domain, Transcription, Elongation, Paf1 Complex, Histone H3 Methylation, H2B Ubiquitination, Cdc73, Leo1, Ctr9, Plus3 Domain, Transcription Regulation, Structural Proteomics In Europe, Spine, Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. N. De Jong, V. Truffault, T. Diercks, E. Ab, M. A. Daniels, R. Kaptein, G. E. Folkers
Structure And Dna Binding Of The Human Rtf1 Plus3 Domain.
Structure V. 16 149 2008
PubMed-ID: 18184592 | Reference-DOI: 10.1016/J.STR.2007.10.018

Molecule 1 - KIAA0252 PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET15B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Variant	:	RIL
	Fragment	:	PLUS3, RESIDUES 228-359
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	SELF MADE CDNA LIBRARY OF MULTIPLE HUMAN CARCINOMA CELL LINES
	Synonym	:	RFT1 PLUS3 DOMAIN

		1
NMR Structure (25x)	:	A
NMR Structure * (1x)	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2BZE)

(no "Site" information available for 2BZE)

(no "SS Bond" information available for 2BZE)

(no "Cis Peptide Bond" information available for 2BZE)

(no "SAP(SNP)/Variant" information available for 2BZE)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PLUS3	PS51360	Plus3 domain profile.	RTF1_HUMAN	353-484	1	A:345-476

NMR Structure * (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PLUS3	PS51360	Plus3 domain profile.	RTF1_HUMAN	353-484	1	A:345-476

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000389629	1a	ENSE00002188164	chr15:41709302-41709511	210	RTF1_HUMAN	1-66	66	0	-	-
1.2	ENST00000389629	2	ENSE00001685099	chr15:41730519-41730629	111	RTF1_HUMAN	67-103	37	0	-	-
1.4b	ENST00000389629	4b	ENSE00001644351	chr15:41745099-41745246	148	RTF1_HUMAN	104-153	50	0	-	-
1.5	ENST00000389629	5	ENSE00000931009	chr15:41749870-41750074	205	RTF1_HUMAN	153-221	69	1	A:-21--20	2
1.6	ENST00000389629	6	ENSE00001029847	chr15:41756969-41757083	115	RTF1_HUMAN	221-259	39	0	-	-
1.7	ENST00000389629	7	ENSE00000931011	chr15:41758339-41758450	112	RTF1_HUMAN	260-297	38	1	A:-19--9	11
1.8	ENST00000389629	8	ENSE00000931012	chr15:41762455-41762590	136	RTF1_HUMAN	297-342	46	0	-	-
1.9	ENST00000389629	9	ENSE00000931013	chr15:41763370-41763547	178	RTF1_HUMAN	342-401	60	1	A:-8-393	57
1.10b	ENST00000389629	10b	ENSE00000931014	chr15:41766818-41766900	83	RTF1_HUMAN	402-429	28	1	A:394-421	28
1.11	ENST00000389629	11	ENSE00001152999	chr15:41767723-41767810	88	RTF1_HUMAN	429-458	30	1	A:421-450	30
1.12	ENST00000389629	12	ENSE00001152995	chr15:41767910-41768017	108	RTF1_HUMAN	459-494	36	1	A:451-476	26
1.13	ENST00000389629	13	ENSE00001152991	chr15:41768644-41768721	78	RTF1_HUMAN	495-520	26	0	-	-
1.14b	ENST00000389629	14b	ENSE00001152986	chr15:41769363-41769484	122	RTF1_HUMAN	521-561	41	0	-	-
1.15	ENST00000389629	15	ENSE00001152980	chr15:41769656-41769713	58	RTF1_HUMAN	561-580	20	0	-	-
1.16	ENST00000389629	16	ENSE00000931020	chr15:41770746-41770823	78	RTF1_HUMAN	581-606	26	0	-	-
1.17	ENST00000389629	17	ENSE00001506418	chr15:41771301-41771396	96	RTF1_HUMAN	607-638	32	0	-	-
1.18	ENST00000389629	18	ENSE00000931022	chr15:41772412-41772523	112	RTF1_HUMAN	639-676	38	0	-	-
1.19b	ENST00000389629	19b	ENSE00001944328	chr15:41772779-41775761	2983	RTF1_HUMAN	676-710	35	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:153
 aligned with RTF1_HUMAN | Q92541 from UniProtKB/Swiss-Prot  Length:710

    Alignment length:298
                                   196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476        
           RTF1_HUMAN   187 MGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALN 484
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------d2bzea1 A:345-476 RNA polymerase-associated protein RTF1 homolog                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..------------------------------------------------------------------------...........-------------------------------------------------------------------------..........hhhhhhhheehhhhhhhhh....hhhhhh..eeeee.........eeeeeeeeeeeeeeeeee..eeeeeeeeee....eeeehhhh......hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------PLUS3  PDB: A:345-476 UniProt: 353-484                                                                                               PROSITE
           Transcript 1 (1) Exon 1.5  PDB: A:-21--20           --------------------------------------Exon 1.7  PDB: A:-19--9 [INCOMPLETE]  --------------------------------------------Exon 1.9  PDB: A:-8-393 UniProt: 342-401 [INCOMPLETE]       Exon 1.10b  PDB: A:394-421  -----------------------------Exon 1.12  PDB: A:451-476  Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.6  PDB: - UniProt: 221-259      -------------------------------------Exon 1.8  PDB: - UniProt: 297-342             --------------------------------------------------------------------------------------Exon 1.11  PDB: A:421-450     -------------------------- Transcript 1 (2)
                 2bze A -21 MG------------------------------------------------------------------------SSHHHHHHSSG-------------------------------------------------------------------------LVPRGSHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALN 476
                             |       -         -         -         -         -         -         -    |  -14    |    -         -         -         -         -         -         -        -7     ||348       358       368       378       388       398       408       418       428       438       448       458       468        
                             |                                                                      -19        -9                                                                        -8     -1|                                                                                                                                   
                           -20                                                                                                                                                                  345

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: SH3-like barrel (1035)

Superfamily: Plus3-like (4)

Family: Plus3 (4)

Protein domain: RNA polymerase-associated protein RTF1 homolog (3)

Human (Homo sapiens) [TaxId: 9606] (3)

d2bzea1

A:345-476

(no "CATH Domain" information available for 2BZE)

(no "Pfam Domain" information available for 2BZE)

NMR Structure(hide GO term definitions)

Chain A (RTF1_HUMAN | Q92541)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003697	single-stranded DNA binding	Interacting selectively and non-covalently with single-stranded DNA.
biological process
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0001832	blastocyst growth	An increase in size of a blastocyst due to expansion of the blastocoelic cavity cell shape changes and cell proliferation.
	GO:0001711	endodermal cell fate commitment	The cell differentiation process that results in commitment of a cell to become part of the endoderm.
	GO:0080182	histone H3-K4 trimethylation	The modification of histone H3 by addition of three methyl groups to lysine at position 4 of the histone.
	GO:0016570	histone modification	The covalent alteration of one or more amino acid residues within a histone protein.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0051571	positive regulation of histone H3-K4 methylation	Any process that activates or increases the frequency, rate or extent of the covalent addition of a methyl group to the lysine at position 4 of histone H3.
	GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides, catalyzed by RNA polymerase II.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0019827	stem cell population maintenance	The process by which an organism or tissue maintains a population of stem cells of a single type. This can be achieved by a number of mechanisms: stem cell asymmetric division maintains stem cell numbers; stem cell symmetric division increases them; maintenance of a stem cell niche maintains the conditions for commitment to the stem cell fate for some types of stem cell; stem cells may arise de novo from other cell types.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0016593	Cdc73/Paf1 complex	A multiprotein complex that associates with RNA polymerase II and general RNA polymerase II transcription factor complexes and may be involved in both transcriptional initiation and elongation. In Saccharomyces the complex contains Paf1p, Cdc73p, Ctr9p, Rtf1p, and Leo1p.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2bze)

	Sites
(no "Sites" information available for 2bze)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bze)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2bze
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RTF1_HUMAN \| Q92541
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RTF1_HUMAN \| Q92541
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	RTF1_HUMAN \| Q92541	:	2db9 3u1u 4l1p 4l1u

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (20, 20)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File