Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  GLU C180 -> GLN VARIANT QUINOL:FUMARATE REDUCTASE FROM WOLINELLA SUCCINOGENES
 
Authors :  C. R. D. Lancaster
Date :  14 May 05  (Deposition) - 13 Dec 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.19
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Oxidoreductase, 2Fe-2S, 3D-Structure, 3Fe-4S, 4Fe-4S, Citric Acid Cycle, Dihaem Cytochrome B, Electron Transport, Fad, Flavoprotein, Fumarate Reductase, Heme, Ion-Sulphur Protein, Iron, Iron- Sulfur, Metal-Binding, Respiratory Chain, Succinate Dehydrogenase, Transmembrane, Tricarboxylic Acid Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. R. D. Lancaster, U. S. Sauer, R. Gross, A. H. Haas, J. Graf, H. Schwalbe, W. Maentele, J. Simon, G. Madej
Experimental Support For The E-Pathway Hypothesis Of Coupled Transmembrane Electron And Proton Transfer In Dihemic Quinol:Fumarate Reductase
Proc. Natl. Acad. Sci. Usa V. 102 18860 2005
PubMed-ID: 16380425  |  Reference-DOI: 10.1073/PNAS.0509711102
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - QUINOL-FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT A
    ChainsA, D
    EC Number1.3.99.1
    Organism ScientificWOLINELLA SUCCINOGENES
    Organism Taxid844
    Other DetailsFAD COVALENTLY BOUND TO HIS A43 BY AN 8- ALPHA-(N-EPSILON-HISTIDYL) BOND
 
Molecule 2 - QUINOL-FUMARATE REDUCTASE IRON-SULFUR SUBUNIT B
    ChainsB, E
    EC Number1.3.99.1
    Organism ScientificWOLINELLA SUCCINOGENES
    Organism Taxid844
 
Molecule 3 - QUINOL-FUMARATE REDUCTASE DIHEME CYTOCHROME B SUBUNIT C
    ChainsC, F
    EC Number1.3.99.1
    Organism ScientificWOLINELLA SUCCINOGENES
    Organism Taxid844

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (8, 18)

Asymmetric/Biological Unit (8, 18)
No.NameCountTypeFull Name
1CIT2Ligand/IonCITRIC ACID
2F3S2Ligand/IonFE3-S4 CLUSTER
3FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
4FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
5HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
6LMT2Ligand/IonDODECYL-BETA-D-MALTOSIDE
7NA2Ligand/IonSODIUM ION
8SF42Ligand/IonIRON/SULFUR CLUSTER

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:371 , MET A:372 , GLY A:373 , GLU A:393 , ALA A:395 , HOH A:2156BINDING SITE FOR RESIDUE NA A1658
02AC2SOFTWARESER D:371 , MET D:372 , GLY D:373 , GLU D:393 , ALA D:395 , HOH D:2162BINDING SITE FOR RESIDUE NA D1658
03AC3SOFTWAREGLY A:12 , GLY A:13 , GLY A:14 , LEU A:15 , ALA A:16 , SER A:35 , LEU A:36 , ILE A:37 , SER A:42 , HIS A:43 , SER A:44 , ALA A:47 , GLY A:49 , GLY A:50 , LYS A:179 , ALA A:181 , ALA A:215 , THR A:216 , GLY A:217 , THR A:227 , ASN A:228 , THR A:235 , HIS A:369 , TYR A:370 , GLY A:392 , GLU A:393 , ARG A:404 , GLY A:407 , ASN A:408 , SER A:409 , VAL A:410 , CIT A:1657 , HOH A:2269 , HOH A:2270 , HOH A:2271 , HOH A:2272 , HOH A:2273BINDING SITE FOR RESIDUE FAD A1656
04AC4SOFTWAREALA A:46 , GLN A:48 , GLY A:49 , PHE A:141 , GLN A:255 , HIS A:257 , LEU A:267 , THR A:269 , GLU A:270 , ARG A:301 , HIS A:369 , ARG A:404 , GLY A:406 , FAD A:1656 , HOH A:2274BINDING SITE FOR RESIDUE CIT A1657
05AC5SOFTWAREVAL B:56 , CYS B:57 , ARG B:58 , GLY B:60 , ILE B:61 , CYS B:62 , GLY B:63 , CYS B:65 , CYS B:77BINDING SITE FOR RESIDUE FES B1240
06AC6SOFTWARECYS B:161 , THR B:163 , CYS B:208 , MET B:209 , THR B:210 , LEU B:211 , LEU B:212 , ALA B:213 , CYS B:214BINDING SITE FOR RESIDUE F3S B1241
07AC7SOFTWARECYS B:151 , ILE B:152 , GLU B:153 , CYS B:154 , GLY B:155 , CYS B:157 , CYS B:218 , PRO B:219 , LYS B:220BINDING SITE FOR RESIDUE SF4 B1242
08AC8SOFTWAREHOH B:2142 , GLN C:30 , SER C:31 , GLY C:34 , LEU C:37 , PHE C:90 , HIS C:93 , ALA C:94 , ALA C:97 , LYS C:100 , PHE C:101 , TRP C:126 , GLY C:133 , MET C:136 , PHE C:137 , HIS C:182 , GLY C:186 , LEU C:190 , LYS C:193 , HEM C:1256 , HOH C:2046 , HOH C:2047BINDING SITE FOR RESIDUE HEM C1255
09AC9SOFTWAREPHE C:40 , MET C:41 , HIS C:44 , LEU C:82 , ALA C:83 , HIS C:143 , MET C:147 , ILE C:154 , SER C:159 , ARG C:162 , TYR C:172 , LEU C:176 , GLY C:224 , PHE C:228 , HEM C:1255BINDING SITE FOR RESIDUE HEM C1256
10BC1SOFTWAREPHE C:101 , PRO C:102 , ASN C:104 , TYR C:108 , MET C:131 , PHE F:95 , MET F:98 , ARG F:99BINDING SITE FOR RESIDUE LMT C1257
11BC2SOFTWAREGLY D:12 , GLY D:13 , GLY D:14 , LEU D:15 , ALA D:16 , SER D:35 , LEU D:36 , ILE D:37 , SER D:42 , HIS D:43 , SER D:44 , ALA D:47 , GLY D:49 , GLY D:50 , LYS D:179 , GLU D:180 , ALA D:181 , ALA D:215 , THR D:216 , GLY D:217 , THR D:227 , ASN D:228 , THR D:235 , HIS D:369 , TYR D:370 , GLY D:392 , GLU D:393 , ARG D:404 , GLY D:407 , ASN D:408 , SER D:409 , VAL D:410 , CIT D:1657 , HOH D:2128 , HOH D:2285 , HOH D:2286 , HOH D:2287 , HOH D:2288BINDING SITE FOR RESIDUE FAD D1656
12BC3SOFTWAREALA D:46 , GLN D:48 , GLY D:49 , PHE D:141 , GLN D:255 , HIS D:257 , LEU D:267 , THR D:269 , GLU D:270 , ARG D:301 , HIS D:369 , ARG D:404 , FAD D:1656 , HOH D:2289 , HOH D:2291BINDING SITE FOR RESIDUE CIT D1657
13BC4SOFTWAREVAL E:56 , CYS E:57 , ARG E:58 , GLY E:60 , ILE E:61 , CYS E:62 , GLY E:63 , CYS E:65 , CYS E:77BINDING SITE FOR RESIDUE FES E1240
14BC5SOFTWARECYS E:161 , THR E:163 , CYS E:208 , MET E:209 , THR E:210 , LEU E:211 , LEU E:212 , ALA E:213 , CYS E:214BINDING SITE FOR RESIDUE F3S E1241
15BC6SOFTWARECYS E:151 , ILE E:152 , GLU E:153 , CYS E:154 , GLY E:155 , CYS E:157 , CYS E:218 , PRO E:219 , LYS E:220BINDING SITE FOR RESIDUE SF4 E1242
16BC7SOFTWAREGLN F:30 , SER F:31 , GLY F:34 , LEU F:37 , PHE F:90 , HIS F:93 , ALA F:94 , ALA F:97 , LYS F:100 , PHE F:101 , TRP F:126 , GLY F:133 , MET F:136 , PHE F:137 , VAL F:179 , HIS F:182 , GLY F:186 , LEU F:190 , LYS F:193 , HEM F:1256 , HOH F:2057 , HOH F:2058 , HOH F:2059BINDING SITE FOR RESIDUE HEM F1255
17BC8SOFTWAREPHE F:40 , MET F:41 , HIS F:44 , LEU F:82 , ALA F:83 , HIS F:143 , MET F:147 , ILE F:154 , SER F:159 , ARG F:162 , TYR F:172 , LEU F:176 , GLY F:224 , PHE F:228 , HEM F:1255BINDING SITE FOR RESIDUE HEM F1256
18BC9SOFTWARELEU C:26 , PHE C:95 , MET C:98 , ARG C:99 , PHE F:101 , PRO F:102 , ASN F:104 , TYR F:108 , MET F:131BINDING SITE FOR RESIDUE LMT F1257

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2BS3)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Phe A:262 -Pro A:263
2Phe D:262 -Pro D:263

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2BS3)

(-) PROSITE Motifs  (5, 10)

Asymmetric/Biological Unit (5, 10)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FRDB_WOLSU5-95
 
  2B:5-95
E:5-95
2FRD_SDH_FAD_BINDINGPS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.FRDA_WOLSU41-50
 
  2A:41-50
D:41-50
32FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FRDB_WOLSU57-65
 
  2B:57-65
E:57-65
44FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.FRDB_WOLSU142-171
 
  2B:142-171
E:142-171
54FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.FRDB_WOLSU151-162
 
  2B:151-162
E:151-162

(-) Exons   (0, 0)

(no "Exon" information available for 2BS3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:656
 aligned with FRDA_WOLSU | P17412 from UniProtKB/Swiss-Prot  Length:656

    Alignment length:656
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650      
           FRDA_WOLSU     1 MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKAVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPGYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGDK 656
               SCOP domains d2bs3a2 A:1-250,A:372-457 Fumarate reductase                                                                                                                                                                                                              d2bs3a3 A:251-371 Fumarate reductase                                                                                     d2bs3a2 A:1-250,A:372-457 Fumarate reductase                                          d2bs3a1 A:458-656 Fumarate reductase                                                                                                                                                                    SCOP domains
               CATH domains 2bs3A01 A:1-258,A:366-436  [code=3.50.50.60, no name defined]                                                                                                                                                                                                     2bs3A02 A:259-365 Flavocytochrome C3; Chain A, domain 1                                                    2bs3A01 A:1-258,A:366-436  [code=3.50.50.60, no name defined]          2bs3A03 A:437-554  [code=1.20.58.100, no name defined]                                                                ------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeee..hhhhhhhhhhhhh....eeee...hhhhhhhhhh...ee.....hhhhh..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.........eeee........eeeehhhhh...............ee....hhhhhhhhhhhhhhhhhh.eee..eeeeeeeee..eeeeeeeee.....eeeee..eeee....hhhhh..........hhhhhhhhh.....ee....eeee............hhhhhhh.eee......hhhhhh..hhhhhhhhhhhhhhhhhhhh...........eeeehhhhhhhhhhhhhhhhhhhhhhh.........eee..eeeee..eee...........eee....ee...........hhhhhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhh..............ee.....eeeeee.........eeeeee.hhhhh..............ee.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh....hhhhh......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------FRD_SDH_FA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bs3 A   1 MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKAVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPGYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGDK 656
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650      

Chain B from PDB  Type:PROTEIN  Length:239
 aligned with FRDB_WOLSU | P17596 from UniProtKB/Swiss-Prot  Length:239

    Alignment length:239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230         
           FRDB_WOLSU     1 MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN 239
               SCOP domains d2bs3b2 B:1-106 Fumarate reductase iron-sulfur protein, N-terminal domain                                 d2bs3b1 B:107-239 Fumarate reductase                                                                                                  SCOP domains
               CATH domains 2bs3B01 B:1-106  [code=3.10.20.30, no name defined]                                                       2bs3B02            -----------2bs3B02 B:107-125,B:137-239 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee..........eeeeeeee.....hhhhhhhhhhhhh..................eeee..eeee.hhh.hhhh...eeeee.....eeee..eeehhhhhhhhhhhh...................hhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----2FE2S_FER_2  PDB: B:5-95 UniProt: 5-95                                                     ----------------------------------------------4FE4S_FER_2  PDB: B:142-171   -------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------2FE2S_FER-------------------------------------------------------------------------------------4FE4S_FER_1 ----------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bs3 B   1 MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN 239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230         

Chain C from PDB  Type:PROTEIN  Length:255
 aligned with FRDC_WOLSU | P17413 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:255
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250     
           FRDC_WOLSU     1 MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTHH 255
               SCOP domains d2bs3c1 C:1-255 Fumarate reductase respiratory complex cytochrome b subunit, FrdC                                                                                                                                                                               SCOP domains
               CATH domains 2bs3C00 C:1-255 FUMARATE REDUCTASE CYTOCHROME B SUBUNIT;                                                                                                                                                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bs3 C   1 MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVQLHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTHH 255
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250     

Chain D from PDB  Type:PROTEIN  Length:656
 aligned with FRDA_WOLSU | P17412 from UniProtKB/Swiss-Prot  Length:656

    Alignment length:656
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650      
           FRDA_WOLSU     1 MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKAVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPGYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGDK 656
               SCOP domains d2bs3d2 D:1-250,D:372-457 Fumarate reductase                                                                                                                                                                                                              d2bs3d3 D:251-371 Fumarate reductase                                                                                     d2bs3d2 D:1-250,D:372-457 Fumarate reductase                                          d2bs3d1 D:458-656 Fumarate reductase                                                                                                                                                                    SCOP domains
               CATH domains 2bs3D01 D:1-258,D:366-436  [code=3.50.50.60, no name defined]                                                                                                                                                                                                     2bs3D02 D:259-365 Flavocytochrome C3; Chain A, domain 1                                                    2bs3D01 D:1-258,D:366-436  [code=3.50.50.60, no name defined]          2bs3D03 D:437-554  [code=1.20.58.100, no name defined]                                                                ------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeee..hhhhhhhhhhhhh....eeee...hhhhhhhhhh...ee.....hhhhh..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.........eeee........eeeehhhhh...............ee....hhhhhhhhhhhhhhhhhh.eee..eeeeeeeee..eeeeeeeee.....eeeee..eeee....hhhhh..........hhhhhhhhh.....ee....eeee............hhhhhhh.eee......hhhhhh..hhhhhhhhhhhhhhhhhhhh...........eeeehhhhhhhhhhhhhhhhhhhhhhh.........eee..eeeee..eee...........eee....ee...........hhhhhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhh..............ee.....eeeeee.........eeeeee.hhhhh..............ee.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh....hhhhh......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------FRD_SDH_FA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bs3 D   1 MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKAVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPGYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGDK 656
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650      

Chain E from PDB  Type:PROTEIN  Length:239
 aligned with FRDB_WOLSU | P17596 from UniProtKB/Swiss-Prot  Length:239

    Alignment length:239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230         
           FRDB_WOLSU     1 MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN 239
               SCOP domains d2bs3e2 E:1-106 Fumarate reductase iron-sulfur protein, N-terminal domain                                 d2bs3e1 E:107-239 Fumarate reductase                                                                                                  SCOP domains
               CATH domains 2bs3E01 E:1-106  [code=3.10.20.30, no name defined]                                                       2bs3E02            -----------2bs3E02 E:107-125,E:137-239 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee..........eeeeeeee.....hhhhhhhhhhhhh..................eeee..eeee.hhh.hhhh...eeeee.....eeee..eeehhhhhhhhhhhh...................hhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----2FE2S_FER_2  PDB: E:5-95 UniProt: 5-95                                                     ----------------------------------------------4FE4S_FER_2  PDB: E:142-171   -------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------2FE2S_FER-------------------------------------------------------------------------------------4FE4S_FER_1 ----------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bs3 E   1 MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN 239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230         

Chain F from PDB  Type:PROTEIN  Length:255
 aligned with FRDC_WOLSU | P17413 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:255
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250     
           FRDC_WOLSU     1 MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTHH 255
               SCOP domains d2bs3f_ F: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2bs3F00 F:1-255 FUMARATE REDUCTASE CYTOCHROME B SUBUNIT;                                                                                                                                                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bs3 F   1 MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVQLHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTHH 255
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (7, 12)

Asymmetric/Biological Unit

(-) CATH Domains  (6, 12)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2BS3)

(-) Gene Ontology  (17, 25)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,D   (FRDA_WOLSU | P17412)
molecular function
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016627    oxidoreductase activity, acting on the CH-CH group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
    GO:0022900    electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0070469    respiratory chain    The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain B,E   (FRDB_WOLSU | P17596)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051538    3 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
    GO:0070469    respiratory chain    The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain C,F   (FRDC_WOLSU | P17413)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016627    oxidoreductase activity, acting on the CH-CH group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0070469    respiratory chain    The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    F3S  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    LMT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SF4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:262 - Pro A:263   [ RasMol ]  
    Phe D:262 - Pro D:263   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2bs3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FRDA_WOLSU | P17412
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDB_WOLSU | P17596
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDC_WOLSU | P17413
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.3.99.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FRDA_WOLSU | P17412
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDB_WOLSU | P17596
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDC_WOLSU | P17413
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FRDA_WOLSU | P174121e7p 1qlb 2bs2 2bs4
        FRDB_WOLSU | P175961e7p 1qlb 2bs2 2bs4
        FRDC_WOLSU | P174131e7p 1qlb 2bs2 2bs4

(-) Related Entries Specified in the PDB File

1e7p QUINOL:FUMARATE REDUCTASE FROM WOLINELLA SUCCINOGENES
1qla RESPIRATORY COMPLEX II-LIKE FUMARATE REDUCTASE FROM WOLINELLA SUCCINOGENES
1qlb RESPIRATORY COMPLEX II-LIKE FUMARATE REDUCTASE FROM WOLINELLA SUCCINOGENES
2bs2 QUINOL:FUMARATE REDUCTASE FROM WOLINELLA SUCCINOGENES
2bs4 GLU C180 -> ILE VARIANT QUINOL:FUMARATE REDUCTASE FROM WOLINELLA SUCCINOGENES