1QLB - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   RESPIRATORY COMPLEX II-LIKE FUMARATE REDUCTASE FROM WOLINELLA SUCCINOGENES

Authors :   C. R. D. Lancaster, A. Kroeger, M. Auer, H. Michel

Date :   25 Aug 99 (Deposition) - 29 Nov 99 (Release) - 18 Jul 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.33

Chains :   Asym./Biol. Unit : A,B,C,D,E,F

Keywords :   Oxidoreductase, Citric Acid Cycle, Respiratory Chain Iron-Sulphur Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. R. D. Lancaster, A. Kroeger, M. Auer, H. Michel
Structure Of Fumarate Reductase From Wolinella Succinogenes At 2. 2 Angstroms Resolution
Nature V. 402 377 1999
PubMed-ID: 10586875 | Reference-DOI: 10.1038/46483

Molecule 1 - FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
	Chains	:	A, D
	EC Number	:	1.3.99.1
	Organism Scientific	:	WOLINELLA SUCCINOGENES
	Organism Taxid	:	844
	Other Details	:	8-ALPHA-[-N-EPSILON-HISTIDYL] COVALENT BOND BETWEEN FLAVIN ADENINE DINUCLEOTIDE (FAD) AND HIS 43

Molecule 2 - FUMARATE REDUCTASE IRON-SULFUR PROTEIN
	Chains	:	B, E
	EC Number	:	1.3.99.1
	Organism Scientific	:	WOLINELLA SUCCINOGENES
	Organism Taxid	:	844

Molecule 3 - FUMARATE REDUCTASE CYTOCHROME B SUBUNIT
	Chains	:	C, F
	Organism Scientific	:	WOLINELLA SUCCINOGENES
	Organism Taxid	:	844
	Other Details	:	HAEM AXIAL LIGANDS - HIS 44, HIS 93, HIS 143, HIS 182

		1	2	3	4	5	6
Asymmetric/Biological Unit	:	A	B	C	D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (8, 18)

No.	Name	Count	Type	Full Name
1	CA	2	Ligand/Ion	CALCIUM ION
2	F3S	2	Ligand/Ion	FE3-S4 CLUSTER
3	FAD	2	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE
4	FES	2	Ligand/Ion	FE2/S2 (INORGANIC) CLUSTER
5	FUM	2	Ligand/Ion	FUMARIC ACID
6	HEM	4	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
7	LMT	2	Ligand/Ion	DODECYL-BETA-D-MALTOSIDE
8	SF4	2	Ligand/Ion	IRON/SULFUR CLUSTER

Asymmetric Unit (18, 18)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLN C:30 , SER C:31 , GLY C:34 , LEU C:37 , PHE C:90 , HIS C:93 , ALA C:94 , ALA C:97 , LYS C:100 , PHE C:101 , TRP C:126 , GLY C:133 , MET C:136 , HIS C:182 , GLY C:183 , GLY C:186 , LEU C:190 , LYS C:193 , HOH C:2022 , HOH C:2023	BINDING SITE FOR RESIDUE HEM C1255
02	AC2	SOFTWARE	PHE C:40 , MET C:41 , HIS C:44 , ALA C:83 , VAL C:86 , HIS C:143 , LEU C:144 , MET C:147 , ILE C:154 , SER C:159 , ARG C:162 , TYR C:172 , LEU C:176 , GLY C:224 , PHE C:228	BINDING SITE FOR RESIDUE HEM C1256
03	AC3	SOFTWARE	VAL B:56 , CYS B:57 , ARG B:58 , GLY B:60 , ILE B:61 , CYS B:62 , GLY B:63 , CYS B:65 , CYS B:77	BINDING SITE FOR RESIDUE FES B1240
04	AC4	SOFTWARE	CYS B:161 , THR B:163 , ALA B:173 , CYS B:208 , MET B:209 , THR B:210 , LEU B:211 , LEU B:212 , ALA B:213 , CYS B:214	BINDING SITE FOR RESIDUE F3S B1241
05	AC5	SOFTWARE	CYS B:151 , ILE B:152 , GLU B:153 , CYS B:154 , GLY B:155 , CYS B:157 , CYS B:218 , PRO B:219	BINDING SITE FOR RESIDUE SF4 B1242
06	AC6	SOFTWARE	GLY A:12 , GLY A:13 , GLY A:14 , LEU A:15 , ALA A:16 , SER A:35 , LEU A:36 , ILE A:37 , SER A:42 , HIS A:43 , SER A:44 , ALA A:47 , GLY A:49 , GLY A:50 , LYS A:179 , ALA A:181 , ALA A:215 , THR A:216 , GLY A:217 , THR A:227 , ASN A:228 , THR A:235 , HIS A:369 , TYR A:370 , GLU A:393 , ARG A:404 , GLY A:407 , ASN A:408 , SER A:409 , VAL A:410 , FUM A:1657 , HOH A:2103 , HOH A:2147 , HOH A:2148 , HOH A:2149	BINDING SITE FOR RESIDUE FAD A1656
07	AC7	SOFTWARE	PHE A:141 , HIS A:257 , LEU A:267 , THR A:269 , ARG A:301 , HIS A:369 , ARG A:404 , GLY A:407 , FAD A:1656 , HOH A:2012 , HOH A:2094	BINDING SITE FOR RESIDUE FUM A1657
08	AC8	SOFTWARE	PRO C:102 , ASN C:104 , TYR C:108 , TRP C:127 , MET C:131 , PHE F:95 , MET F:98 , ARG F:99	BINDING SITE FOR RESIDUE LMT C1257
09	AC9	SOFTWARE	SER A:371 , MET A:372 , GLY A:373 , GLU A:393 , ALA A:395 , HOH A:2105	BINDING SITE FOR RESIDUE CA A1658
10	BC1	SOFTWARE	HOH E:2083 , GLN F:30 , SER F:31 , GLY F:34 , LEU F:37 , PHE F:90 , HIS F:93 , ALA F:94 , ALA F:97 , LYS F:100 , PHE F:101 , TRP F:126 , GLY F:133 , MET F:136 , HIS F:182 , GLY F:183 , GLY F:186 , LEU F:190 , LYS F:193 , HOH F:2022	BINDING SITE FOR RESIDUE HEM F1255
11	BC2	SOFTWARE	PHE F:40 , MET F:41 , HIS F:44 , ALA F:83 , VAL F:86 , HIS F:143 , LEU F:144 , MET F:147 , ILE F:154 , SER F:159 , ARG F:162 , TYR F:172 , LEU F:176 , GLY F:224 , PHE F:228	BINDING SITE FOR RESIDUE HEM F1256
12	BC3	SOFTWARE	VAL E:56 , CYS E:57 , ARG E:58 , GLY E:60 , ILE E:61 , CYS E:62 , GLY E:63 , CYS E:65 , CYS E:77	BINDING SITE FOR RESIDUE FES E1240
13	BC4	SOFTWARE	CYS E:161 , THR E:163 , ALA E:173 , CYS E:208 , MET E:209 , THR E:210 , LEU E:211 , LEU E:212 , ALA E:213 , CYS E:214	BINDING SITE FOR RESIDUE F3S E1241
14	BC5	SOFTWARE	CYS E:151 , ILE E:152 , GLU E:153 , CYS E:154 , GLY E:155 , CYS E:157 , CYS E:218 , PRO E:219	BINDING SITE FOR RESIDUE SF4 E1242
15	BC6	SOFTWARE	GLY D:12 , GLY D:13 , GLY D:14 , LEU D:15 , ALA D:16 , SER D:35 , LEU D:36 , ILE D:37 , SER D:42 , HIS D:43 , SER D:44 , ALA D:47 , GLY D:49 , GLY D:50 , LYS D:179 , ALA D:181 , ALA D:215 , THR D:216 , GLY D:217 , THR D:227 , ASN D:228 , THR D:235 , HIS D:369 , TYR D:370 , GLU D:393 , ARG D:404 , GLY D:407 , ASN D:408 , SER D:409 , VAL D:410 , FUM D:1657 , HOH D:2103 , HOH D:2146 , HOH D:2147 , HOH D:2148	BINDING SITE FOR RESIDUE FAD D1656
16	BC7	SOFTWARE	PHE D:141 , HIS D:257 , LEU D:267 , THR D:269 , ARG D:301 , HIS D:369 , ARG D:404 , GLY D:407 , FAD D:1656 , HOH D:2013 , HOH D:2108	BINDING SITE FOR RESIDUE FUM D1657
17	BC8	SOFTWARE	PHE C:95 , MET C:98 , ARG C:99 , PRO F:102 , ASN F:104 , TYR F:108 , TRP F:127 , MET F:131	BINDING SITE FOR RESIDUE LMT F1257
18	BC9	SOFTWARE	SER D:371 , MET D:372 , GLY D:373 , GLU D:393 , ALA D:395 , HOH D:2094	BINDING SITE FOR RESIDUE CA D1658

(no "SS Bond" information available for 1QLB)

Asymmetric/Biological Unit

No.	Residues
1	Phe A:262	-	Pro A:263
2	Phe D:262	-	Pro D:263

(no "SAP(SNP)/Variant" information available for 1QLB)

Asymmetric/Biological Unit (5, 10)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	2FE2S_FER_2	PS51085	2Fe-2S ferredoxin-type iron-sulfur binding domain profile.	FRDB_WOLSU	5-95	2	B:5-95 E:5-95
2	FRD_SDH_FAD_BINDING	PS00504	Fumarate reductase / succinate dehydrogenase FAD-binding site.	FRDA_WOLSU	41-50	2	A:41-50 D:41-50
3	2FE2S_FER_1	PS00197	2Fe-2S ferredoxin-type iron-sulfur binding region signature.	FRDB_WOLSU	57-65	2	B:57-65 E:57-65
4	4FE4S_FER_2	PS51379	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	FRDB_WOLSU	142-171	2	B:142-171 E:142-171
5	4FE4S_FER_1	PS00198	4Fe-4S ferredoxin-type iron-sulfur binding region signature.	FRDB_WOLSU	151-162	2	B:151-162 E:151-162

(no "Exon" information available for 1QLB)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:655
 aligned with FRDA_WOLSU | P17412 from UniProtKB/Swiss-Prot  Length:656

    Alignment length:655
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650     
           FRDA_WOLSU     1 MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKAVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPGYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGD 655
               SCOP domains d1qlba2 A:1-250,A:372-457 Fumarate reductase                                                                                                                                                                                                              d1qlba3 A:251-371 Fumarate reductase                                                                                     d1qlba2 A:1-250,A:372-457 Fumarate reductase                                          d1qlba1 A:458-655 Fumarate reductase                                                                                                                                                                   SCOP domains
               CATH domains 1qlbA01 A:1-258,A:366-436  [code=3.50.50.60, no name defined]                                                                                                                                                                                                     1qlbA02 A:259-365 Flavocytochrome C3; Chain A, domain 1                                                    1qlbA01 A:1-258,A:366-436  [code=3.50.50.60, no name defined]          1qlbA03 A:437-554  [code=1.20.58.100, no name defined]                                                                ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.eeee..hhhhhhhhhhhhh....eeee...hhhhhhhhhh..........hhhhh..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.........eeee........eeeehhhhh.....................hhhhhhhhhhhhhhhhhh.eee..eeeeeee.......eeeeee.....eeeeee.eeee....hhhhh..........hhhhhhhhh...........eeee....................eee......hhhhhh..hhhhhhhhhhhhhhhhhhhh...eee..eeeeeee..............hhhhhhhhh.........eee..eeeee................eee................hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhh.....................eeeeee.........eeeeee.hhhhh.................hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh....hhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------FRD_SDH_FA----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qlb A   1 MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKSVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPRYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGD 655
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650

Chain B from PDB  Type:PROTEIN  Length:239
 aligned with FRDB_WOLSU | P17596 from UniProtKB/Swiss-Prot  Length:239

    Alignment length:239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230         
           FRDB_WOLSU     1 MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN 239
               SCOP domains d1qlbb2 B:1-106 Fumarate reductase iron-sulfur protein, N-terminal domain                                 d1qlbb1 B:107-239 Fumarate reductase                                                                                                  SCOP domains
               CATH domains 1qlbB01 B:1-106  [code=3.10.20.30, no name defined]                                                       1qlbB02            -----------1qlbB02 B:107-125,B:137-239 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee..........eeeeeeee.....hhhhhhhhhhhhh..................eeee..eeee.hhh.hhhh...eeeeee....eeee..eeehhhhhhhhhhhh...................hhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----2FE2S_FER_2  PDB: B:5-95 UniProt: 5-95                                                     ----------------------------------------------4FE4S_FER_2  PDB: B:142-171   -------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------2FE2S_FER-------------------------------------------------------------------------------------4FE4S_FER_1 ----------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qlb B   1 MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN 239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain C from PDB  Type:PROTEIN  Length:254
 aligned with FRDC_WOLSU | P17413 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:254
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250    
           FRDC_WOLSU     1 MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTH 254
               SCOP domains d1qlbc_ C: Fumarate reductase respiratory complex cytochrome b subunit, FrdC                                                                                                                                                                                   SCOP domains
               CATH domains 1qlbC00 C:1-254 FUMARATE REDUCTASE CYTOCHROME B SUBUNIT;                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qlb C   1 MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTH 254
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250

Chain D from PDB  Type:PROTEIN  Length:655
 aligned with FRDA_WOLSU | P17412 from UniProtKB/Swiss-Prot  Length:656

    Alignment length:655
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650     
           FRDA_WOLSU     1 MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKAVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPGYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGD 655
               SCOP domains d1qlbd2 D:1-250,D:372-457 Fumarate reductase                                                                                                                                                                                                              d1qlbd3 D:251-371 Fumarate reductase                                                                                     d1qlbd2 D:1-250,D:372-457 Fumarate reductase                                          d1qlbd1 D:458-655 Fumarate reductase                                                                                                                                                                   SCOP domains
               CATH domains 1qlbD01 D:1-258,D:366-436  [code=3.50.50.60, no name defined]                                                                                                                                                                                                     1qlbD02 D:259-365 Flavocytochrome C3; Chain A, domain 1                                                    1qlbD01 D:1-258,D:366-436  [code=3.50.50.60, no name defined]          1qlbD03 D:437-554  [code=1.20.58.100, no name defined]                                                                ----------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ------FAD_binding_2-1qlbD01 D:7-410                                                                                                                                                                                                                                                                                                                                                                                       --------------------------------------------------------Succ_DH_flav_C-1qlbD03 D:467-597                                                                                                   ---------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ------FAD_binding_2-1qlbD02 D:7-410                                                                                                                                                                                                                                                                                                                                                                                       --------------------------------------------------------Succ_DH_flav_C-1qlbD04 D:467-597                                                                                                   ---------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ..eeee.eeee..hhhhhhhhhhhhh....eeee...hhhhhhhhhh..........hhhhh..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.........eeee........eeeehhhhh.....................hhhhhhhhhhhhhhhhhh.eee..eeeeeee.......eeeeee.....eeeeee.eeee....hhhhh..........hhhhhhhhh...........eeee....................eee......hhhhhh..hhhhhhhhhhhhhhhhhhhh...eee..eeeeeee..............hhhhhhhhh.........eee..eeeee................eee................hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhh.....................eeeeee.........eeeeee.hhhhh.................hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh....hhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------FRD_SDH_FA----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qlb D   1 MKVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVESKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKSVKELEELYKKSKNVGIKNKRLHANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYEALDVNEMEIAPRYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQEALMPYELPAKYKARNERLGD 655
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650

Chain E from PDB  Type:PROTEIN  Length:239
 aligned with FRDB_WOLSU | P17596 from UniProtKB/Swiss-Prot  Length:239

    Alignment length:239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230         
           FRDB_WOLSU     1 MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN 239
               SCOP domains d1qlbe2 E:1-106 Fumarate reductase iron-sulfur protein, N-terminal domain                                 d1qlbe1 E:107-239 Fumarate reductase                                                                                                  SCOP domains
               CATH domains 1qlbE01 E:1-106  [code=3.10.20.30, no name defined]                                                       1qlbE02            -----------1qlbE02 E:107-125,E:137-239 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                   CATH domains
           Pfam domains (1) -----Fer2_3-1qlbE03 E:6-112                                                                                     ----------------------------------Fer4_8-1qlbE01 E:147-222                                                    ----------------- Pfam domains (1)
           Pfam domains (2) -----Fer2_3-1qlbE04 E:6-112                                                                                     ----------------------------------Fer4_8-1qlbE02 E:147-222                                                    ----------------- Pfam domains (2)
         Sec.struct. author ...eeeeeeee..........eeeeeeee.....hhhhhhhhhhhhh..................eeee..eeee.hhh.hhhh...eeee......eeee..eeehhhhhhhhhhhh...................hhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----2FE2S_FER_2  PDB: E:5-95 UniProt: 5-95                                                     ----------------------------------------------4FE4S_FER_2  PDB: E:142-171   -------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------2FE2S_FER-------------------------------------------------------------------------------------4FE4S_FER_1 ----------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qlb E   1 MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN 239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain F from PDB  Type:PROTEIN  Length:254
 aligned with FRDC_WOLSU | P17413 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:254
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250    
           FRDC_WOLSU     1 MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTH 254
               SCOP domains d1qlbf_ F: Fumarate reductase respiratory complex cytochrome b subunit, FrdC                                                                                                                                                                                   SCOP domains
               CATH domains 1qlbF00 F:1-254 FUMARATE REDUCTASE CYTOCHROME B SUBUNIT;                                                                                                                                                                                                       CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------Sdh_cyt-1qlbF01 F:105-226                                                                                                 ---------------------------- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------Sdh_cyt-1qlbF02 F:105-226                                                                                                 ---------------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qlb F   1 MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTH 254
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: 4Fe-4S (51)

Family: Fer4_8 (6)

Wolinella succinogenes (1)

1a	Fer4_8-1qlbE01	E:147-222
1b	Fer4_8-1qlbE02	E:147-222

Clan: Fer2 (69)

Family: Fer2_3 (6)

Wolinella succinogenes (1)

2a	Fer2_3-1qlbE03	E:6-112
2b	Fer2_3-1qlbE04	E:6-112

Clan: FumRed-TM (17)

Family: Sdh_cyt (10)

Wolinella succinogenes (1)

3a	Sdh_cyt-1qlbF01	F:105-226
3b	Sdh_cyt-1qlbF02	F:105-226

Clan: NADP_Rossmann (1239)

Family: FAD_binding_2 (21)

Wolinella succinogenes (1)

4a	FAD_binding_2-1qlbD01	D:7-410
4b	FAD_binding_2-1qlbD02	D:7-410

Clan: no clan defined [family: Succ_DH_flav_C] (11)

Family: Succ_DH_flav_C (11)

Wolinella succinogenes (1)

5a	Succ_DH_flav_C-1qlbD03	D:467-597
5b	Succ_DH_flav_C-1qlbD04	D:467-597

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,D (FRDA_WOLSU | P17412)

molecular function
	GO:0050660	flavin adenine dinucleotide binding	Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
	GO:0022900	electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain B,E (FRDB_WOLSU | P17596)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0051538	3 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0008177	succinate dehydrogenase (ubiquinone) activity	Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006099	tricarboxylic acid cycle	A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain C,F (FRDC_WOLSU | P17413)

molecular function
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006099	tricarboxylic acid cycle	A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		F3S	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FES	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FUM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		LMT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SF4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Phe A:262 - Pro A:263	[ RasMol ]
		Phe D:262 - Pro D:263	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qlb
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FRDA_WOLSU \| P17412
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	FRDB_WOLSU \| P17596
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	FRDC_WOLSU \| P17413
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.3.99.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FRDA_WOLSU \| P17412
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	FRDB_WOLSU \| P17596
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	FRDC_WOLSU \| P17413
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	FRDA_WOLSU \| P17412	:	1e7p 2bs2 2bs3 2bs4
	FRDB_WOLSU \| P17596	:	1e7p 2bs2 2bs3 2bs4
	FRDC_WOLSU \| P17413	:	1e7p 2bs2 2bs3 2bs4

1fum	STRUCTURE OF THE E. COLI FUMARATE REDUCTASE RESPIRATORY COMPLEX
1qla	RESPIRATORY COMPLEX II-LIKE FUMARATE REDUCTASE FROM WOLINELLA SUCCINOGENES

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (8, 18)

Sites (18, 18)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (5, 10)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (6, 12)

CATH Domains (6, 12)

Pfam Domains (5, 10)

Gene Ontology (17, 25)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File