2BP1 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF THE AFLATOXIN ALDEHYDE REDUCTASE IN COMPLEX WITH NADPH

Authors :   J. E. Debreczeni, P. Lukacik, K. Kavanagh, E. Dubinina, J. Bray, S. Cole A. Haroniti, A. Edwards, C. Arrowsmith, M. Sundstrom, F. Von Delft, O U. Oppermann

Date :   17 Apr 05 (Deposition) - 11 May 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Oxidoreductase, Aldo-Keto Reductase Family 7, Ssa Reductase, Tim Barrel (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. E. Debreczeni, P. Lukacik, K. Kavanagh, E. Dubinina, J. Bray, S. Colebrook, A. Haroniti, A. Edwards, C. Arrowsmith, M. Sundstrom, F. Von Delft, O. Gileadi, U. Oppermann
Structure Of The Aflatoxin Aldehyde Reductase In Complex With Nadph
To Be Published
PubMed: search

Molecule 1 - AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PLIC-SGC
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Variant	:	ROSETTA
	Fragment	:	RESIDUES 30-359
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	AFLATOXIN ALDEHYDE REDUCTASE, AFB1-AR 1, ALDOKETOREDUCTASE 7

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 8)

No.	Name	Count	Type	Full Name
1	FLC	4	Ligand/Ion	CITRATE ANION
2	NDP	4	Ligand/Ion	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Biological Unit 1 (2, 4)

No.	Name	Count	Type	Full Name
1	FLC	2	Ligand/Ion	CITRATE ANION
2	NDP	2	Ligand/Ion	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	FLC	2	Ligand/Ion	CITRATE ANION
2	NDP	2	Ligand/Ion	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	MET A:46 , MET A:77 , TYR A:78 , HIS A:142 , TRP A:257 , TYR A:261 , ARG A:264 , ARG A:360 , NDP A:1361	BINDING SITE FOR RESIDUE FLC A1362
2	AC2	SOFTWARE	MET B:46 , MET B:77 , TYR B:78 , HIS B:142 , TRP B:257 , THR B:260 , TYR B:261 , ARG B:264 , ARG B:360 , NDP B:1361	BINDING SITE FOR RESIDUE FLC B1362
3	AC3	SOFTWARE	MET C:46 , MET C:77 , TYR C:78 , HIS C:142 , TRP C:257 , TYR C:261 , ARG C:264 , ARG C:360 , NDP C:1361	BINDING SITE FOR RESIDUE FLC C1362
4	AC4	SOFTWARE	MET D:46 , MET D:77 , TYR D:78 , HIS D:142 , TYR D:261 , ARG D:264 , ARG D:360 , NDP D:1361	BINDING SITE FOR RESIDUE FLC D1362
5	AC5	SOFTWARE	GLY A:44 , THR A:45 , MET A:46 , ARG A:51 , ASP A:73 , TYR A:78 , HIS A:142 , SER A:172 , ASN A:173 , GLN A:198 , TYR A:226 , ASN A:227 , PRO A:228 , LEU A:229 , ALA A:230 , GLY A:231 , GLY A:232 , THR A:235 , LYS A:237 , TYR A:238 , ARG A:251 , TYR A:261 , ILE A:315 , GLY A:317 , MET A:318 , SER A:319 , GLN A:323 , GLN A:326 , ASN A:327 , FLC A:1362 , HOH A:2118 , HOH A:2123 , HOH A:2147 , HOH A:2148 , HOH A:2149 , HOH A:2150	BINDING SITE FOR RESIDUE NDP A1361
6	AC6	SOFTWARE	GLY B:44 , THR B:45 , MET B:46 , ASP B:73 , TYR B:78 , HIS B:142 , SER B:172 , ASN B:173 , GLN B:198 , TYR B:226 , ASN B:227 , PRO B:228 , LEU B:229 , ALA B:230 , GLY B:231 , GLY B:232 , THR B:235 , LYS B:237 , TYR B:238 , ARG B:251 , TYR B:261 , ILE B:315 , GLY B:317 , MET B:318 , SER B:319 , GLN B:323 , GLN B:326 , ASN B:327 , FLC B:1362 , HOH B:2079 , HOH B:2140 , HOH B:2141 , HOH B:2142 , HOH B:2143 , HOH B:2144	BINDING SITE FOR RESIDUE NDP B1361
7	AC7	SOFTWARE	GLY C:44 , THR C:45 , MET C:46 , ASP C:73 , TYR C:78 , SER C:172 , ASN C:173 , GLN C:198 , TYR C:226 , ASN C:227 , PRO C:228 , LEU C:229 , ALA C:230 , GLY C:231 , GLY C:232 , THR C:235 , LYS C:237 , TYR C:238 , GLY C:250 , ARG C:251 , TYR C:261 , ILE C:315 , GLY C:317 , MET C:318 , SER C:319 , GLN C:323 , GLN C:326 , ASN C:327 , ARG C:360 , FLC C:1362 , HOH C:2080 , HOH C:2142 , HOH C:2143 , HOH C:2144 , HOH C:2145	BINDING SITE FOR RESIDUE NDP C1361
8	AC8	SOFTWARE	GLY D:44 , THR D:45 , MET D:46 , ASP D:73 , TYR D:78 , SER D:172 , ASN D:173 , GLN D:198 , TYR D:226 , ASN D:227 , PRO D:228 , LEU D:229 , ALA D:230 , GLY D:231 , GLY D:232 , LYS D:237 , TYR D:238 , GLY D:250 , ARG D:251 , TYR D:261 , ILE D:315 , GLY D:317 , MET D:318 , SER D:319 , GLN D:323 , GLN D:326 , ASN D:327 , ARG D:360 , FLC D:1362 , HOH D:2067 , HOH D:2099 , HOH D:2100 , HOH D:2101	BINDING SITE FOR RESIDUE NDP D1361

(no "SS Bond" information available for 2BP1)

(no "Cis Peptide Bond" information available for 2BP1)

Asymmetric Unit (7, 28)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048209	V	135	M	ARK72_HUMAN	Polymorphism	6670759	A/B/C/D	V	136	M
2	UniProt	VAR_017413	A	142	T	ARK72_HUMAN	Polymorphism	1043657	A/B/C/D	A	143	T
3	UniProt	VAR_017414	Q	157	H	ARK72_HUMAN	Polymorphism	859208	A/B/C/D	Q	158	H
4	UniProt	VAR_060222	E	180	K	ARK72_HUMAN	Polymorphism	859210	A/B/C/D	E	181	K
5	UniProt	VAR_048210	G	198	S	ARK72_HUMAN	Polymorphism	2231200	A/B/C/D	G	199	S
6	UniProt	VAR_017415	C	214	Y	ARK72_HUMAN	Polymorphism	2235794	A/B/C/D	C	215	Y
7	UniProt	VAR_048211	S	255	N	ARK72_HUMAN	Polymorphism	2231203	A/B/C/D	S	256	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048209	V	135	M	ARK72_HUMAN	Polymorphism	6670759	A/B	V	136	M
2	UniProt	VAR_017413	A	142	T	ARK72_HUMAN	Polymorphism	1043657	A/B	A	143	T
3	UniProt	VAR_017414	Q	157	H	ARK72_HUMAN	Polymorphism	859208	A/B	Q	158	H
4	UniProt	VAR_060222	E	180	K	ARK72_HUMAN	Polymorphism	859210	A/B	E	181	K
5	UniProt	VAR_048210	G	198	S	ARK72_HUMAN	Polymorphism	2231200	A/B	G	199	S
6	UniProt	VAR_017415	C	214	Y	ARK72_HUMAN	Polymorphism	2235794	A/B	C	215	Y
7	UniProt	VAR_048211	S	255	N	ARK72_HUMAN	Polymorphism	2231203	A/B	S	256	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048209	V	135	M	ARK72_HUMAN	Polymorphism	6670759	C/D	V	136	M
2	UniProt	VAR_017413	A	142	T	ARK72_HUMAN	Polymorphism	1043657	C/D	A	143	T
3	UniProt	VAR_017414	Q	157	H	ARK72_HUMAN	Polymorphism	859208	C/D	Q	158	H
4	UniProt	VAR_060222	E	180	K	ARK72_HUMAN	Polymorphism	859210	C/D	E	181	K
5	UniProt	VAR_048210	G	198	S	ARK72_HUMAN	Polymorphism	2231200	C/D	G	199	S
6	UniProt	VAR_017415	C	214	Y	ARK72_HUMAN	Polymorphism	2235794	C/D	C	215	Y
7	UniProt	VAR_048211	S	255	N	ARK72_HUMAN	Polymorphism	2231203	C/D	S	256	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2BP1)

Asymmetric Unit (7, 28)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000235835	1a	ENSE00000872932	chr1:19638640-19638321	320	ARK72_HUMAN	1-100	100	4	A:38-101 B:38-101 (gaps) C:38-101 (gaps) D:38-101	64 64 64 64
1.2a	ENST00000235835	2a	ENSE00001601047	chr1:19635136-19634949	188	ARK72_HUMAN	100-162	63	4	A:101-163 B:101-163 C:101-163 D:101-163	63 63 63 63
1.3a	ENST00000235835	3a	ENSE00001736745	chr1:19634756-19634652	105	ARK72_HUMAN	163-197	35	4	A:164-198 B:164-198 C:164-198 D:164-198	35 35 35 35
1.4	ENST00000235835	4	ENSE00001617062	chr1:19633904-19633808	97	ARK72_HUMAN	198-230	33	4	A:199-231 B:199-231 C:199-231 D:199-231	33 33 33 33
1.5	ENST00000235835	5	ENSE00001647259	chr1:19633595-19633496	100	ARK72_HUMAN	230-263	34	4	A:231-264 B:231-264 C:231-264 D:231-264	34 34 34 34
1.6	ENST00000235835	6	ENSE00001610778	chr1:19632641-19632512	130	ARK72_HUMAN	263-306	44	4	A:264-307 B:264-307 C:264-307 D:264-307	44 44 44 44
1.7e	ENST00000235835	7e	ENSE00001188305	chr1:19630880-19630459	422	ARK72_HUMAN	307-359	53	4	A:308-360 B:308-360 C:308-360 D:308-360	53 53 53 53

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:323
 aligned with ARK72_HUMAN | O43488 from UniProtKB/Swiss-Prot  Length:359

    Alignment length:323
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356   
          ARK72_HUMAN    37 RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR 359
               SCOP domains d2bp1a_ A: automated matches                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 2bp1A00 A:38-360 NADP-dependent oxidoreductase                                                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee........hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhh............eeeeee........hhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhh.eeeee..hhhhhhhh..hhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhh.eeee...hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------M------T--------------H----------------------K-----------------S---------------Y----------------------------------------N-------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:38-101 UniProt: 1-100 [INCOMPLETE]            --------------------------------------------------------------Exon 1.3a  PDB: A:164-198          Exon 1.4  PDB: A:199-231         --------------------------------Exon 1.6  PDB: A:264-307 UniProt: 263-306   Exon 1.7e  PDB: A:308-360 UniProt: 307-359            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.2a  PDB: A:101-163 UniProt: 100-162                     -------------------------------------------------------------------Exon 1.5  PDB: A:231-264          ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2bp1 A  38 RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR 360
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357

Chain B from PDB  Type:PROTEIN  Length:320
 aligned with ARK72_HUMAN | O43488 from UniProtKB/Swiss-Prot  Length:359

    Alignment length:323
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356   
          ARK72_HUMAN    37 RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR 359
               SCOP domains d2bp1b_ B: automated matches                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 2bp1B00 B:38-360 NADP-dependent oxidoreductase                                                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee........hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhh......---...eeeeee........hhhhhhhhhhhhhhhh....eeeeee.......hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhh.eeeee..hhhhhhhh..hhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhh.eeee...hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------M------T--------------H----------------------K-----------------S---------------Y----------------------------------------N-------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: B:38-101 (gaps) UniProt: 1-100 [INCOMPLETE]     --------------------------------------------------------------Exon 1.3a  PDB: B:164-198          Exon 1.4  PDB: B:199-231         --------------------------------Exon 1.6  PDB: B:264-307 UniProt: 263-306   Exon 1.7e  PDB: B:308-360 UniProt: 307-359            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.2a  PDB: B:101-163 UniProt: 100-162                     -------------------------------------------------------------------Exon 1.5  PDB: B:231-264          ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2bp1 B  38 RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLG---CRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR 360
                                    47        57        67        77        87       | - |     107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357   
                                                                                    95  99

Chain C from PDB  Type:PROTEIN  Length:320
 aligned with ARK72_HUMAN | O43488 from UniProtKB/Swiss-Prot  Length:359

    Alignment length:323
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356   
          ARK72_HUMAN    37 RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR 359
               SCOP domains d2bp1c_ C: automated matches                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 2bp1C00 C:38-360 NADP-dependent oxidoreductase                                                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee........hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhh......---...eeeeee........hhhhhhhhhhhhhhhh....eeeeee.......hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhh.eeeee..hhhhhhhh..hhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhh.eeee...hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------M------T--------------H----------------------K-----------------S---------------Y----------------------------------------N-------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: C:38-101 (gaps) UniProt: 1-100 [INCOMPLETE]     --------------------------------------------------------------Exon 1.3a  PDB: C:164-198          Exon 1.4  PDB: C:199-231         --------------------------------Exon 1.6  PDB: C:264-307 UniProt: 263-306   Exon 1.7e  PDB: C:308-360 UniProt: 307-359            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.2a  PDB: C:101-163 UniProt: 100-162                     -------------------------------------------------------------------Exon 1.5  PDB: C:231-264          ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2bp1 C  38 RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLG---CRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR 360
                                    47        57        67        77        87       | - |     107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357   
                                                                                    95  99

Chain D from PDB  Type:PROTEIN  Length:323
 aligned with ARK72_HUMAN | O43488 from UniProtKB/Swiss-Prot  Length:359

    Alignment length:323
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356   
          ARK72_HUMAN    37 RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR 359
               SCOP domains d2bp1d_ D: automated matches                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 2bp1D00 D:38-360 NADP-dependent oxidoreductase                                                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee........hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhh............eeeeee........hhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhh.eeeee..hhhhhhhh..hhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh...hhhhh.eeee...hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------M------T--------------H----------------------K-----------------S---------------Y----------------------------------------N-------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: D:38-101 UniProt: 1-100 [INCOMPLETE]            --------------------------------------------------------------Exon 1.3a  PDB: D:164-198          Exon 1.4  PDB: D:199-231         --------------------------------Exon 1.6  PDB: D:264-307 UniProt: 263-306   Exon 1.7e  PDB: D:308-360 UniProt: 307-359            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.2a  PDB: D:101-163 UniProt: 100-162                     -------------------------------------------------------------------Exon 1.5  PDB: D:231-264          ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2bp1 D  38 RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR 360
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: TIM beta/alpha-barrel (3956)

Superfamily: NAD(P)-linked oxidoreductase (286)

Family: Aldo-keto reductases (NADP) (251)

Protein domain: automated matches (62)

Human (Homo sapiens) [TaxId: 9606] (48)

1a	d2bp1a_	A:
1b	d2bp1b_	B:
1c	d2bp1c_	C:
1d	d2bp1d_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Barrel (2994)

Topology: TIM Barrel (2806)

Homologous Superfamily: NADP-dependent oxidoreductase (181)

Human (Homo sapiens) (116)

1a	2bp1B00	B:38-360
1b	2bp1C00	C:38-360
1c	2bp1A00	A:38-360
1d	2bp1D00	D:38-360

(no "Pfam Domain" information available for 2BP1)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (ARK72_HUMAN | O43488)

molecular function
	GO:0004032	alditol:NADP+ 1-oxidoreductase activity	Catalysis of the reaction: an alditol + NADP+ = an aldose + NADPH + H+.
	GO:0004033	aldo-keto reductase (NADP) activity	Catalysis of the reaction: an alcohol + NADP+ = an aldehyde or a ketone + NADPH + H+.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
	GO:0019119	phenanthrene-9,10-epoxide hydrolase activity	Catalysis of the reaction: phenanthrene-9,10-oxide + H2O = trans-9,10-dihydrodiolphenanthrene.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0006081	cellular aldehyde metabolic process	The chemical reactions and pathways involving aldehydes, any organic compound with the formula R-CH=O, as carried out by individual cells.
	GO:0044597	daunorubicin metabolic process	The chemical reactions and pathways involving daunorubicin, a chemotherapeutic of the anthracycline family that is given as a treatment for some types of cancer.
	GO:0044598	doxorubicin metabolic process	The chemical reactions and pathways involving doxorubicin, an anthracycline antibiotic, used in cancer chemotherapy.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FLC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bp1)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2bp1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARK72_HUMAN \| O43488
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ARK72_HUMAN \| O43488
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2BP1)

(no "Related Entries Specified in the PDB File" available for 2BP1)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (7, 28)

PROSITE Motifs (0, 0)

Exons (7, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (17, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File