|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 2) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2BF9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2BF9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2BF9) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2BF9) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:36 aligned with PAHO_MELGA | P68249 from UniProtKB/Swiss-Prot Length:36 Alignment length:36 10 20 30 PAHO_MELGA 1 GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY 36 SCOP domains d2bf9a_ A: Pancreatic polypeptide SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------ SAPs(SNPs) PROSITE (1) PANCREATIC_HORMONE_2 PDB: A:1-36 PROSITE (1) PROSITE (2) -------------------PANCREATIC_HORMON PROSITE (2) Transcript ------------------------------------ Transcript 2bf9 A 1 GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRy 36 10 20 30 | 36-TYC
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2BF9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BF9) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (PAHO_MELGA | P68249)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|