Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  X-RAY ANALYSIS (1.4-ANGSTROMS RESOLUTION) OF AVIAN PANCREATIC POLYPEPTIDE. SMALL GLOBULAR PROTEIN HORMONE
 
Authors :  T. L. Blundell, J. E. Pitts, I. J. Tickle, S. P. Wood
Date :  16 Jan 81  (Deposition) - 19 Feb 81  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.37
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Pancreatic Hormone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. L. Blundell, J. E. Pitts, I. J. Tickle, S. P. Wood, C. W. Wu
X-Ray Analysis (1. 4-A Resolution) Of Avian Pancreatic Polypeptide: Small Globular Protein Hormone.
Proc. Natl. Acad. Sci. Usa V. 78 4175 1981
PubMed-ID: 16593056  |  Reference-DOI: 10.1073/PNAS.78.7.4175
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - AVIAN PANCREATIC POLYPEPTIDE
    Chains: A
    Engineered: YES
    Organism Common: TURKEY
    Organism Scientific: MELEAGRIS GALLOPAVO
    Organism Taxid: 9103

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1ZN1Ligand/IonZINC ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1ZN-1Ligand/IonZINC ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:1 , ASN A:23 , HIS A:34BINDING SITE FOR RESIDUE ZN A 37

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1PPT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PPT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PPT)

(-) PROSITE Motifs  (2, 2)

Asymmetric Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PANCREATIC_HORMONE_2PS50276 Pancreatic hormone family profile.PAHO_MELGA1-36  1A:1-36
2PANCREATIC_HORMONE_1PS00265 Pancreatic hormone family signature.PAHO_MELGA20-36  1A:20-36
Biological Unit 1 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PANCREATIC_HORMONE_2PS50276 Pancreatic hormone family profile.PAHO_MELGA1-36  2A:1-36
2PANCREATIC_HORMONE_1PS00265 Pancreatic hormone family signature.PAHO_MELGA20-36  2A:20-36

(-) Exons   (0, 0)

(no "Exon" information available for 1PPT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:36
 aligned with PAHO_MELGA | P68249 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:36
                                    10        20        30      
            PAHO_MELGA    1 GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY 36
               SCOP domains d1ppta_ A: Pancreatic polypeptide    SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains Hormone_3-1pptA01 A:1-36             Pfam domains
         Sec.struct. author .hhhhhhh.....hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                PROSITE (1) PANCREATIC_HORMONE_2  PDB: A:1-36    PROSITE (1)
                PROSITE (2) -------------------PANCREATIC_HORMON PROSITE (2)
                 Transcript ------------------------------------ Transcript
                  1ppt A  1 GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY 36
                                    10        20        30
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Peptides (792)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1PPT)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: no clan defined [family: Hormone_3] (12)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A   (PAHO_MELGA | P68249)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ppt)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)
Insightii
  monomer: ribbon, secondary structure, sticks, Zn, labeling
[ mono GIF format | stereo GIF format ]
  monomer: ribbon, sticks, Zn, labeling
[ mono GIF format | stereo GIF format ]
  dimer: ribbon, sticks, Zn
[ mono GIF format | stereo GIF format ]
  dimer: ribbon, sticks, Zn
[ mono GIF format | stereo GIF format ]
Setor
  monomer: ribbon
[ mono GIF format | stereo GIF format ]
  monomer: ribbon, sticks, labeling, no Zn
[ mono GIF format | stereo GIF format ]
  monomer: spacefill
[ mono GIF format | stereo GIF format ]
Distance Plot
  monomer: representative atom: CA
[ mono GIF format | mono PDF format ]

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ppt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PAHO_MELGA | P68249
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PAHO_MELGA | P68249
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PAHO_MELGA | P68249: 2bf9 2h3s 2h3t 2h4b

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PPT)