Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF THE PROTEIN COMPLEX OF YEAST HSP40 SIS1 AND HSP70 SSA1
 
Authors :  J. Li, Y. Wu, X. Qian, B. Sha
Date :  16 Sep 05  (Deposition) - 19 Sep 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Hsp40 Sis1 Hsp70 Ssa1, Chaperone/Protein Transport Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Li, Y. Wu, X. Qian, B. Sha
Crystal Structure Of Yeast Sis1 Peptide-Binding Fragment And Hsp70 Ssa1 C-Terminal Complex.
Biochem. J. V. 398 353 2006
PubMed-ID: 16737444  |  Reference-DOI: 10.1042/BJ20060618
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SIS1 PROTEIN
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28B
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: YEAST HSP40 SIS1 C-TERMINAL DOMAIN
    Gene: SIS1
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
 
Molecule 2 - HEAT SHOCK 70 KDA PROTEIN COGNATE 2
    Chains: D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28B
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: YEAST HSP70 SSA1 C-TERMINAL DOMAIN
    Gene: HSC70-2, HSC2
    Organism Common: FRUIT FLY
    Organism Scientific: DROSOPHILA MELANOGASTER
    Organism Taxid: 7227
    Synonym: HEAT SHOCK 70 KDA PROTEIN 87D

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2B26)

(-) Sites  (0, 0)

(no "Site" information available for 2B26)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2B26)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2B26)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2B26)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2B26)

(-) Exons   (1, 3)

Asymmetric/Biological Unit (1, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YNL007C1YNL007C.1XIV:619568-6185101059SIS1_YEAST1-3523523A:180-349 (gaps)
B:180-349 (gaps)
C:190-349 (gaps)		170
170
160

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:157
 aligned with SIS1_YEAST | P25294 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:170
                                   189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349
           SIS1_YEAST   180 ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID 349
               SCOP domains d2b26a1 A:180-259 Heat shock protein 40 Sis1                                    d2b26a2 A:260-349 Heat shock protein 40 Sis1                                               SCOP domains
               CATH domains 2b26A01 A:180-257 Urease metallochaperone UreE, N-ter             minal domain2b26A02 A:258-338 Urease metallochaperone UreE, N-terminal domain                ----------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeehhhhhhhh...eeeeee.......eeeeee...........ee.-------------..eeeeeeee.....eeee..eeeeeeee.hhhhh.....eee.....eee...........eeeeeeeeee.......eeeeeeeeee......hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: A:180-349 (gaps) UniProt: 1-352 [INCOMPLETE]                                                                                                                Transcript 1
                 2b26 A 180 ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKIT-------------RKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID 349
                                   189       199       209       219       229  |      -      |249       259       269       279       289       299       309       319       329       339       349
                                                                              232           246                                                                                                       


Chain B from PDB  Type:PROTEIN  Length:147
 aligned with SIS1_YEAST | P25294 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:170
                                   189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349
           SIS1_YEAST   180 ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID 349
               SCOP domains d2b26b1 B:180-259 Heat             shock protein 40 Sis1                        d2b26b2 B:260-349 Heat shock protein 40 Sis1                                               SCOP domains
               CATH domains 2b26B01 B:180-257 Urea            se metallochaperone Ur           eE, N-termi2b26B02 B:258-338 Urease metallochaperone UreE, N-terminal domain                ----------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeehhhhhhhh.eeee------------...eeee.........eeee..-----------..eeeeeee.....eeee..eeeeeeeeehhhhhhheeeeee.....eeeeee.........eee................eeeeeeee.....hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:180-349 (gaps) UniProt: 1-352 [INCOMPLETE]                                                                                                                Transcript 1
                 2b26 B 180 ETVQVNLPVSLEDLFVGKKKSF------------KTQIDIQLKPGWKAGTKITYKN-----------KTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID 349
                                   189       199 |       -    |  219       229     |   -       249       259       269       279       289       299       309       319       329       339       349
                                               201          214                  235         247                                                                                                      


Chain C from PDB  Type:PROTEIN  Length:122
 aligned with SIS1_YEAST | P25294 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:160
                                   199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349
           SIS1_YEAST   190 LEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID 349
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------2b26C02 C:258-338 Urease metallochaperone UreE, N-terminal domain                ----------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh.....----------------............----------------------.........eeee..eeeeeeeehhhhhhh..........................eeee.....ee..eeeee..eeeeeee........hhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: C:190-349 (gaps) UniProt: 1-352 [INCOMPLETE]                                                                                                      Transcript 1
                 2b26 C 190 LEDLFVGKKKSF----------------DIQLKPGWKAGT----------------------VIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID 349
                                   199 |       -       219       229         -         -  |    259       269       279       289       299       309       319       329       339       349
                                     201              218        229                    252                                                                                                 


Chain D from PDB  Type:PROTEIN  Length:7
 aligned with HSP7B_DROME | P11146 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:7
          HSP7B_DROME   626 PTVEEVD 632
               SCOP domains ------- SCOP domains
               CATH domains ------- CATH domains
               Pfam domains ------- Pfam domains
         Sec.struct. author ...ee.. Sec.struct. author
                 SAPs(SNPs) ------- SAPs(SNPs)
                    PROSITE ------- PROSITE
                 Transcript ------- Transcript
                 2b26 D   1 PTVEEVD   7
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 5)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2B26)

(-) Gene Ontology  (17, 19)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (SIS1_YEAST | P25294)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0051787    misfolded protein binding    Interacting selectively and non-covalently with a misfolded protein.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0051082    unfolded protein binding    Interacting selectively and non-covalently with an unfolded protein.
biological process
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0070843    misfolded protein transport    The directed movement of misfolded proteins in a cell, including the movement of proteins between specific compartments or structures within a cell.
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0035719    tRNA import into nucleus    The directed movement of tRNA from the cytoplasm to the nucleus.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
    GO:0071630    ubiquitin-dependent catabolism of misfolded proteins by nucleus-associated proteasome    The chemical reactions and pathways resulting in the breakdown of misfolded proteins via a mechanism in which the proteins are transported to the nucleus for ubiquitination, and then targeted to proteasomes for degradation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0022627    cytosolic small ribosomal subunit    The small subunit of a ribosome located in the cytosol.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain D   (HSP7B_DROME | P11146)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0051082    unfolded protein binding    Interacting selectively and non-covalently with an unfolded protein.
biological process
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0009408    response to heat    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
cellular component
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2b26)
 
  Sites
(no "Sites" information available for 2b26)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2b26)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2b26
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HSP7B_DROME | P11146
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  SIS1_YEAST | P25294
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HSP7B_DROME | P11146
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SIS1_YEAST | P25294
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SIS1_YEAST | P25294: 1c3g 4rwu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2B26)