|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2ZXJ) |
Sites (0, 0)| (no "Site" information available for 2ZXJ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2ZXJ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2ZXJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2ZXJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2ZXJ) |
Exons (0, 0)| (no "Exon" information available for 2ZXJ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:100 aligned with WALR_STAAU | Q9RDT5 from UniProtKB/Swiss-Prot Length:233 Alignment length:100 142 152 162 172 182 192 202 212 222 232 WALR_STAAU 133 NEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQH 232 SCOP domains d2zxja_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 2zxj A 133 NEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQH 232 142 152 162 172 182 192 202 212 222 232 Chain B from PDB Type:PROTEIN Length:100 aligned with WALR_STAAU | Q9RDT5 from UniProtKB/Swiss-Prot Length:233 Alignment length:100 142 152 162 172 182 192 202 212 222 232 WALR_STAAU 133 NEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQH 232 SCOP domains d2zxjb_ B: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) --------------------Trans_reg_C-2zxjB01 B:153-229 --- Pfam domains (1) Pfam domains (2) --------------------Trans_reg_C-2zxjB02 B:153-229 --- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 2zxj B 133 NEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQH 232 142 152 162 172 182 192 202 212 222 232
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2ZXJ) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (WALR_STAAU | Q9RDT5)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|