2ZNE - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF ZN2+-BOUND FORM OF DES3-23ALG-2 COMPLEXED WITH ALIX ABS PEPTIDE

Authors :   H. Suzuki, M. Kawasaki, T. Inuzuka, T. Kakiuchi, H. Shibata, S. Wakatsuki, M. Maki

Date :   22 Apr 08 (Deposition) - 09 Sep 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)
Biol. Unit 3: A,B,C,D  (1x)

Keywords :   Penta-Ef-Hand Protein, Calcium Binding Protein, Apoptosis, Endoplasmic Reticulum, Membrane, Nucleus, Polymorphism, Cytoplasm, Host-Virus Interaction, Protein Transport, Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Suzuki, M. Kawasaki, T. Inuzuka, M. Okumura, T. Kakiuchi, H. Shibata, S. Wakatsuki, M. Maki
Structural Basis For Ca(2+)-Dependent Formation Of Alg-2/Alix Peptide Complex: Ca(2+)/Ef3-Driven Arginine Switch Mechanism
Structure V. 16 1562 2008
PubMed-ID: 18940611 | Reference-DOI: 10.1016/J.STR.2008.07.012
(for further references see the PDB file header)

Molecule 1 - PROGRAMMED CELL DEATH PROTEIN 6
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET3D
	Expression System Strain	:	BL21(DE3)PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 2-191
	Gene	:	PDCD6, ALG2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	APOPTOSIS-LINKED GENE 2 PROTEIN, PROBABLE CALCIUM- BINDING PROTEIN ALG-2

Molecule 2 - 16-MERIC PEPTIDE FROM PROGRAMMED CELL DEATH 6- INTERACTING PROTEIN
	Chains	:	C, D
	Engineered	:	YES
	Fragment	:	ALG-2 BINDING SITE, RESIDUES 799-814
	Mutation	:	YES
	Other Details	:	CHEMICAL SYNTHESIS; THIS SEQUENCE OCCURS NATURALLY IN HUMANS.
	Synonym	:	PDCD6-INTERACTING PROTEIN, ALG-2-INTERACTING PROTEIN 1, HP95
	Synthetic	:	YES

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D
Biological Unit 3 (1x)	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 10)

No.	Name	Count	Type	Full Name
1	NA	2	Ligand/Ion	SODIUM ION
2	ZN	8	Ligand/Ion	ZINC ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	NA	-1	Ligand/Ion	SODIUM ION
2	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	NA	-1	Ligand/Ion	SODIUM ION
2	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 3 (0, 0)

No.	Name	Count	Type	Full Name
1	NA	-1	Ligand/Ion	SODIUM ION
2	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP A:36 , ASP A:38 , SER A:40 , VAL A:42 , GLU A:47	BINDING SITE FOR RESIDUE ZN A 991
02	AC2	SOFTWARE	ASP A:103 , ASP A:105 , SER A:107 , MET A:109 , GLU A:114 , ZN A:994	BINDING SITE FOR RESIDUE ZN A 992
03	AC3	SOFTWARE	ASP A:171 , ASP A:173 , NA A:995 , HOH A:1000 , HOH A:1018	BINDING SITE FOR RESIDUE ZN A 993
04	AC4	SOFTWARE	ASP A:105 , ASP A:111 , GLU A:114 , ZN A:992 , HOH A:1021	BINDING SITE FOR RESIDUE ZN A 994
05	AC5	SOFTWARE	ASP B:36 , ASP B:38 , SER B:40 , VAL B:42 , GLU B:47 , HOH B:1028	BINDING SITE FOR RESIDUE ZN B 991
06	AC6	SOFTWARE	ASP B:103 , ASP B:105 , SER B:107 , MET B:109 , GLU B:114 , ZN B:994	BINDING SITE FOR RESIDUE ZN B 992
07	AC7	SOFTWARE	NA B:1 , ASP B:171 , ASP B:173 , HOH B:1007 , HOH B:1017	BINDING SITE FOR RESIDUE ZN B 993
08	AC8	SOFTWARE	ASP B:105 , ASP B:111 , GLN B:145 , ZN B:992 , HOH B:995	BINDING SITE FOR RESIDUE ZN B 994
09	AC9	SOFTWARE	ASP B:169 , ASP B:171 , ASP B:173 , TRP B:175 , ZN B:993 , HOH B:1005 , HOH B:1017	BINDING SITE FOR RESIDUE NA B 1
10	BC1	SOFTWARE	ASP A:169 , ASP A:171 , ASP A:173 , TRP A:175 , ZN A:993 , HOH A:1019	BINDING SITE FOR RESIDUE NA A 995

(no "SS Bond" information available for 2ZNE)

Asymmetric Unit

No.	Residues
1	Pro C:12	-	Gly C:13
2	Gln D:1	-	Gly D:2

Asymmetric Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035459	G	123	C	PDCD6_HUMAN	Unclassified	---	A/B	G	123	C
2	CancerSNP	VAR_PDCD6_HUMAN_CCDS3854_1_01 *	G	123	C	PDCD6_HUMAN	Disease (Breast cancer)	---	A/B	G	123	C
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035459	G	123	C	PDCD6_HUMAN	Unclassified	---	A	G	123	C
2	CancerSNP	VAR_PDCD6_HUMAN_CCDS3854_1_01 *	G	123	C	PDCD6_HUMAN	Disease (Breast cancer)	---	A	G	123	C
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035459	G	123	C	PDCD6_HUMAN	Unclassified	---	B	G	123	C
2	CancerSNP	VAR_PDCD6_HUMAN_CCDS3854_1_01 *	G	123	C	PDCD6_HUMAN	Disease (Breast cancer)	---	B	G	123	C
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035459	G	123	C	PDCD6_HUMAN	Unclassified	---	A/B	G	123	C
2	CancerSNP	VAR_PDCD6_HUMAN_CCDS3854_1_01 *	G	123	C	PDCD6_HUMAN	Disease (Breast cancer)	---	A/B	G	123	C
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	PDCD6_HUMAN	23-58 90-125 156-191	4	- A:90-125 B:90-125 A:156-191 B:156-191
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	PDCD6_HUMAN	36-48 103-115	4	A:36-48 B:36-48 A:103-115 B:103-115

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	PDCD6_HUMAN	23-58 90-125 156-191	2	- A:90-125 - A:156-191 -
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	PDCD6_HUMAN	36-48 103-115	2	A:36-48 - A:103-115 -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	PDCD6_HUMAN	23-58 90-125 156-191	2	- - B:90-125 - B:156-191
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	PDCD6_HUMAN	36-48 103-115	2	- B:36-48 - B:103-115

Biological Unit 3 (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	PDCD6_HUMAN	23-58 90-125 156-191	4	- A:90-125 B:90-125 A:156-191 B:156-191
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	PDCD6_HUMAN	36-48 103-115	4	A:36-48 B:36-48 A:103-115 B:103-115

Asymmetric Unit (2, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000307296	1b	ENSE00001884181	chr3:33839844-33840429	586	PDC6I_HUMAN	1-70	70	0	-	-
1.4	ENST00000307296	4	ENSE00001770534	chr3:33853564-33853618	55	PDC6I_HUMAN	70-88	19	0	-	-
1.5b	ENST00000307296	5b	ENSE00001632925	chr3:33855051-33855120	70	PDC6I_HUMAN	89-112	24	0	-	-
1.6c	ENST00000307296	6c	ENSE00001802994	chr3:33863447-33863574	128	PDC6I_HUMAN	112-154	43	0	-	-
1.7d	ENST00000307296	7d	ENSE00001141015	chr3:33866679-33866832	154	PDC6I_HUMAN	155-206	52	0	-	-
1.8b	ENST00000307296	8b	ENSE00001141009	chr3:33867972-33868072	101	PDC6I_HUMAN	206-239	34	0	-	-
1.10c	ENST00000307296	10c	ENSE00001141002	chr3:33870345-33870461	117	PDC6I_HUMAN	240-278	39	0	-	-
1.12b	ENST00000307296	12b	ENSE00001608471	chr3:33877536-33877758	223	PDC6I_HUMAN	279-353	75	0	-	-
1.13b	ENST00000307296	13b	ENSE00001630102	chr3:33879696-33879819	124	PDC6I_HUMAN	353-394	42	0	-	-
1.14	ENST00000307296	14	ENSE00001140976	chr3:33883389-33883566	178	PDC6I_HUMAN	394-453	60	0	-	-
1.15b	ENST00000307296	15b	ENSE00001785905	chr3:33885604-33885715	112	PDC6I_HUMAN	454-491	38	0	-	-
1.16	ENST00000307296	16	ENSE00001732288	chr3:33886911-33887080	170	PDC6I_HUMAN	491-547	57	0	-	-
1.18a	ENST00000307296	18a	ENSE00001783635	chr3:33893980-33894228	249	PDC6I_HUMAN	548-630	83	0	-	-
1.19b	ENST00000307296	19b	ENSE00001596979	chr3:33895371-33895505	135	PDC6I_HUMAN	631-675	45	0	-	-
1.20b	ENST00000307296	20b	ENSE00001097440	chr3:33896658-33896752	95	PDC6I_HUMAN	676-707	32	0	-	-
1.21c	ENST00000307296	21c	ENSE00001140939	chr3:33905498-33905621	124	PDC6I_HUMAN	707-748	42	0	-	-
1.22b	ENST00000307296	22b	ENSE00001140934	chr3:33906735-33906922	188	PDC6I_HUMAN	749-811	63	2	C:2-13 D:1-12	12 12
1.23b	ENST00000307296	23b	ENSE00001218677	chr3:33907843-33911194	3352	PDC6I_HUMAN	811-868	58	1	C:13-16 -	4 -

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:168
 aligned with PDCD6_HUMAN | O75340 from UniProtKB/Swiss-Prot  Length:191

    Alignment length:168
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183        
          PDCD6_HUMAN    24 DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV 191
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhh.......hhhhhhhhh........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh......eehhhhhhhhhhhh...hhhhhhhhhhhhh.....eehhhhhhhhhhhhhhhhhhhhh.......eeeeehhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------------------------------------------------------------------C-------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------C-------------------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) EF_HAND_2  PDB: - UniProt: 23-58   -------------------------------EF_HAND_2  PDB: A:90-125            ------------------------------EF_HAND_2  PDB: A:156-191            PROSITE (1)
                PROSITE (2) ------------EF_HAND_1    ------------------------------------------------------EF_HAND_1    ---------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2zne A  24 DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV 191
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183

Chain B from PDB  Type:PROTEIN  Length:167
 aligned with PDCD6_HUMAN | O75340 from UniProtKB/Swiss-Prot  Length:191

    Alignment length:167
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       
          PDCD6_HUMAN    25 QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV 191
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------EF_hand_6-2zneB03 B:39-90                           EF_hand_5-2zneB01 B:91-155                                       ------------------------------------ Pfam domains (1)
           Pfam domains (2) --------------EF_hand_6-2zneB04 B:39-90                           EF_hand_5-2zneB02 B:91-155                                       ------------------------------------ Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhh......eehhhhhhh.........hhhhhhhhhhhhh.....eehhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.....eeeeehhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------------------------------C-------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------C-------------------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) EF_HAND_2  PDB: - UniProt: 23-58  -------------------------------EF_HAND_2  PDB: B:90-125            ------------------------------EF_HAND_2  PDB: B:156-191            PROSITE (1)
                PROSITE (2) -----------EF_HAND_1    ------------------------------------------------------EF_HAND_1    ---------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zne B  25 QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV 191
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184

Chain C from PDB  Type:PROTEIN  Length:15
 aligned with PDC6I_HUMAN | Q8WUM4 from UniProtKB/Swiss-Prot  Length:868

    Alignment length:15
                                   809     
          PDC6I_HUMAN   800 GPPYPTYPGYPGYCQ 814
               SCOP domains --------------- SCOP domains
               CATH domains --------------- CATH domains
               Pfam domains --------------- Pfam domains
         Sec.struct. author ............... Sec.struct. author
                 SAPs(SNPs) --------------- SAPs(SNPs)
                    PROSITE --------------- PROSITE
           Transcript 1 (1) Exon 1.22b  --- Transcript 1 (1)
           Transcript 1 (2) -----------1.23 Transcript 1 (2)
                 2zne C   2 GPPYPTYPGYPGYSQ  16
                                    11

Chain D from PDB  Type:PROTEIN  Length:12
 aligned with PDC6I_HUMAN | Q8WUM4 from UniProtKB/Swiss-Prot  Length:868

    Alignment length:12
                                   808  
          PDC6I_HUMAN   799 QGPPYPTYPGYP 810
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author ............ Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
           Transcript 1 (1) Exon 1.22b   Transcript 1 (1)
           Transcript 1 (2) ------------ Transcript 1 (2)
                 2zne D   1 QGPPYPTYPGYP  12
                                    10

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2ZNE)

(no "CATH Domain" information available for 2ZNE)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: EF_hand (270)

Family: EF_hand_5 (126)

Homo sapiens (Human) (31)

1a	EF_hand_5-2zneB01	B:91-155
1b	EF_hand_5-2zneB02	B:91-155

Family: EF_hand_6 (75)

Homo sapiens (Human) (34)

2a	EF_hand_6-2zneB03	B:39-90
2b	EF_hand_6-2zneB04	B:39-90

Asymmetric Unit(hide GO term definitions)

Chain A,B (PDCD6_HUMAN | O75340)

molecular function
	GO:0060090	binding, bridging	The binding activity of a molecule that brings together two or more molecules through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0004198	calcium-dependent cysteine-type endopeptidase activity	Catalysis of the hydrolysis of nonterminal peptide bonds in a polypeptide chain by a mechanism using a cysteine residue at the enzyme active center, and requiring the presence of calcium.
	GO:0048306	calcium-dependent protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0043495	protein anchor	Interacting selectively and non-covalently with both a protein or protein complex and a membrane, in order to maintain the localization of the protein at a specific membrane location.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0097190	apoptotic signaling pathway	A series of molecular signals which triggers the apoptotic death of a cell. The pathway starts with reception of a signal, and ends when the execution phase of apoptosis is triggered.
	GO:0034605	cellular response to heat	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0032007	negative regulation of TOR signaling	Any process that stops, prevents, or reduces the frequency, rate or extent of TOR signaling.
	GO:0051898	negative regulation of protein kinase B signaling	Any process that stops, prevents, or reduces the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
	GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of vascular endothelial growth factor receptor signaling pathway activity.
	GO:0045766	positive regulation of angiogenesis	Any process that activates or increases angiogenesis.
	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that activates or increases the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0010595	positive regulation of endothelial cell migration	Any process that increases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
	GO:0001938	positive regulation of endothelial cell proliferation	Any process that activates or increases the rate or extent of endothelial cell proliferation.
	GO:0051592	response to calcium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0036324	vascular endothelial growth factor receptor-2 signaling pathway	Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor-2 (VEGFR-2) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0070971	endoplasmic reticulum exit site	An endoplasmic reticulum part at which COPII-coated vesicles are produced.
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,D (PDC6I_HUMAN | Q8WUM4)

molecular function
	GO:0048306	calcium-dependent protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0031871	proteinase activated receptor binding	Interacting selectively and non-covalently with a proteinase activated receptor.
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0000920	cell separation after cytokinesis	The process of physically separating progeny cells after cytokinesis; this may involve enzymatic digestion of septum or cell wall components.
	GO:0007080	mitotic metaphase plate congression	The cell cycle process in which chromosomes are aligned at the metaphase plate, a plane halfway between the poles of the mitotic spindle, during mitosis.
	GO:0036258	multivesicular body assembly	The aggregation, arrangement and bonding together of a set of components to form a multivesicular body, a type of late endosome in which regions of the limiting endosomal membrane invaginate to form internal vesicles; membrane proteins that enter the internal vesicles are sequestered from the cytoplasm.
	GO:0006997	nucleus organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the nucleus.
	GO:1903543	positive regulation of exosomal secretion	Any process that activates or increases the frequency, rate or extent of exosomal secretion.
	GO:1903553	positive regulation of extracellular exosome assembly	Any process that activates or increases the frequency, rate or extent of extracellular vesicular exosome assembly.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0010824	regulation of centrosome duplication	Any process that modulates the frequency, rate or extent of centrosome duplication. Centrosome duplication is the replication of a centrosome, a structure comprised of a pair of centrioles and peri-centriolar material from which a microtubule spindle apparatus is organized.
	GO:1903551	regulation of extracellular exosome assembly	Any process that modulates the frequency, rate or extent of extracellular vesicular exosome assembly.
	GO:1901673	regulation of mitotic spindle assembly	Any process that modulates the frequency, rate or extent of mitotic spindle assembly.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0090611	ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway	The chemical reactions and pathways resulting in the breakdown of a protein or peptide, via the multivesicular body (MVB) sorting pathway; proteins are sorted into MVBs, and delivered to a lysosome/vacuole for degradation. This process is independent of ubiquitination.
	GO:0039702	viral budding via host ESCRT complex	Viral budding which uses a host ESCRT protein complex, or complexes, to mediate the budding process.
	GO:0019058	viral life cycle	A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070971	endoplasmic reticulum exit site	An endoplasmic reticulum part at which COPII-coated vesicles are produced.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:1903561	extracellular vesicle	Any vesicle that is part of the extracellular region.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0001772	immunological synapse	An area of close contact between a lymphocyte (T-, B-, or natural killer cell) and a target cell formed through the clustering of particular signaling and adhesion molecules and their associated membrane rafts on both the lymphocyte and the target cell and facilitating activation of the lymphocyte, transfer of membrane from the target cell to the lymphocyte, and in some situations killing of the target cell through release of secretory granules and/or death-pathway ligand-receptor interaction.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gln D:1 - Gly D:2	[ RasMol ]
		Pro C:12 - Gly C:13	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2zne
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PDC6I_HUMAN \| Q8WUM4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PDCD6_HUMAN \| O75340
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PDC6I_HUMAN \| Q8WUM4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PDCD6_HUMAN \| O75340
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

2zn8	CRYSTAL STRUCTURE OF ZN2+-BOUND FORM OF ALG-2
2zn9	CRYSTAL STRUCTURE OF CA2+-BOUND FORM OF DES3-20ALG-2
2znd	CRYSTAL STRUCTURE OF CA2+-FREE FORM OF DES3-20ALG-2

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (2, 8)

Exons (2, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (2, 4)

Gene Ontology (62, 71)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File