Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE FERREDOXIN-FERREDOXIN REDUCTASE (BPHA3-BPHA4)COMPLEX
 
Authors :  T. Senda, M. Senda
Date :  12 Apr 07  (Deposition) - 23 Oct 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B,P
Keywords :  Electron Transfer, Ferredoxin, Ferredoxin Reductase, Oxidoreductase/Electron Transport Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Senda, S. Kishigami, S. Kimura, M. Fukuda, T. Ishida, T. Senda
Molecular Mechanism Of The Redox-Dependent Interaction Between Nadh-Dependent Ferredoxin Reductase And Rieske-Type [2Fe-2S] Ferredoxin
J. Mol. Biol. V. 373 382 2007
PubMed-ID: 17850818  |  Reference-DOI: 10.1016/J.JMB.2007.08.002
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FERREDOXIN REDUCTASE
    ChainsA, P
    EC Number1.18.1.2
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneBPHA4
    Organism ScientificPSEUDOMONAS SP.
    Organism Taxid306
    StrainSTRAIN KKS102
    SynonymFERREDOXIN REDUCTASE BPHA4
 
Molecule 2 - BIPHENYL DIOXYGENASE FERREDOXIN SUBUNIT
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneBPHA3
    Organism ScientificPSEUDOMONAS SP.
    Organism Taxid306
    StrainSTRAIN KKS102

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
3NAI2Ligand/Ion1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS B:43 , HIS B:45 , GLY B:46 , CYS B:63 , LEU B:65 , HIS B:66 , PRO B:82BINDING SITE FOR RESIDUE FES B 500
2AC2SOFTWAREGLY A:14 , GLY A:16 , LEU A:17 , ALA A:18 , GLY A:39 , ASP A:40 , GLU A:41 , ARG A:48 , PRO A:49 , ALA A:82 , ALA A:108 , THR A:109 , GLY A:110 , ARG A:130 , GLY A:272 , ASP A:273 , THR A:290 , TRP A:291 , SER A:292 , ALA A:294 , TYR A:319 , TRP A:320BINDING SITE FOR RESIDUE FAD A 501
3AC3SOFTWAREGLY P:14 , GLY P:16 , LEU P:17 , ALA P:18 , VAL P:38 , ASP P:40 , GLU P:41 , ARG P:48 , PRO P:49 , LYS P:53 , THR P:81 , ALA P:82 , ALA P:108 , THR P:109 , GLY P:110 , ARG P:130 , GLU P:159 , GLY P:272 , ASP P:273 , GLU P:289 , THR P:290 , TRP P:291 , ALA P:294 , TYR P:319 , TRP P:320 , NAI P:504 , HOH P:508 , HOH P:522 , HOH P:526 , HOH P:527 , HOH P:535BINDING SITE FOR RESIDUE FAD P 502
4AC4SOFTWAREVAL A:151 , GLY A:152 , GLY A:153 , GLY A:154 , VAL A:155 , ILE A:156 , VAL A:174 , GLU A:175 , THR A:176 , SER A:182 , ARG A:183 , GLY A:234 , ILE A:235 , GLY A:236 , VAL A:237 , GLU A:289BINDING SITE FOR RESIDUE NAI A 503
5AC5SOFTWAREARG P:114 , GLY P:154 , VAL P:155 , ILE P:156 , GLU P:175 , THR P:176 , GLN P:177 , ARG P:183 , GLY P:234 , ILE P:235 , GLY P:236 , GLU P:289 , FAD P:502 , HOH P:519 , HOH P:531BINDING SITE FOR RESIDUE NAI P 504

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2YVJ)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ala A:8 -Pro A:9
2Pro B:80 -Pro B:81
3Ala P:8 -Pro P:9
4Ser P:209 -Val P:210

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2YVJ)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIESKEPS51296 Rieske [2Fe-2S] iron-sulfur domain profile.BPHA3_PSES14-100  1B:4-100

(-) Exons   (0, 0)

(no "Exon" information available for 2YVJ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:402
 aligned with Q52437_PSES1 | Q52437 from UniProtKB/TrEMBL  Length:408

    Alignment length:402
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404  
         Q52437_PSES1     5 ALKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFERSVTGSVDGVVLLDDGTRIAADMVVVGIGVLANDALARAAGLACDDGIFVDAYGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAVARHLVDPTAPGYAELPWYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTLIELQKGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKLAAAV 406
               SCOP domains d2yvja1 A:5-115,A:237-308 NADH-dependent ferredoxin reductase, BphA4                                           d2yvja2 A:116-236 NADH-dependent ferredoxin reductase, BphA4                                                             d2yvja1 A:5-115,A:237-308 NADH-dependent ferredoxin reductase, BphA4    d2yvja3 A:309-406 NADH-dependent ferredoxin reductase, BphA4                                       SCOP domains
               CATH domains 2yvjA01 A:5-110,A:239-317  [code=3.50.50.60, no name defined]                                             ---2yvjA02 A:114-236  [code=3.50.50.60, no name defined]                                                                      --2yvjA01 A:5-110,A:239-317  [code=3.50.50.60, no name defined]                  2yvjA03 A:318-406  [code=3.30.390.30, no name defined]                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeee..hhhhhhhhhhhhh......eeeee........hhhhhhhhhhhh...............eeee...eeeee....eeee....eee..eeee...eee............ee.....hhhhhhhh.....eeeeee..hhhhhhhhhhhhhhheeeeee...........hhhhhhhhhhhhhh..eeee....eeeee..eeee....eee...eee...eee.hhhhhhh.......ee...........eee....eeee......eee..hhhhhhhhhhhhhhhhhh..........eeeee....eeeeee.....eeeeeee......eeeeeeee..eeeeeeee.hhhhhhhhhhhhhh....hhhhhhh...hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2yvj A   5 ALKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFERSVTGSVDGVVLLDDGTRIAADMVVVGIGVLANDALARAAGLACDDGIFVDAYGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAVARHLVDPTAPGYAELPWYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTLIELQKGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKLAAAV 406
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404  

Chain B from PDB  Type:PROTEIN  Length:106
 aligned with BPHA3_PSES1 | Q52440 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    11        21        31        41        51        61        71        81        91       101      
          BPHA3_PSES1     2 TFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSRAAL 107
               SCOP domains d2yvjb_ B: automated matches                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains Rieske-2yvjB01 B:2-96                                                                          ----------- Pfam domains
         Sec.struct. author ..eeeee........eeeeee..eeeeeeee..eeeeee..............eee..eee......eee.....eee........ee.eee...eeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --RIESKE  PDB: B:4-100 UniProt: 4-100                                                              ------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 2yvj B   2 TFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSRAAL 107
                                    11        21        31        41        51        61        71        81        91       101      

Chain P from PDB  Type:PROTEIN  Length:401
 aligned with Q52437_PSES1 | Q52437 from UniProtKB/TrEMBL  Length:408

    Alignment length:401
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405 
         Q52437_PSES1     6 LKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFERSVTGSVDGVVLLDDGTRIAADMVVVGIGVLANDALARAAGLACDDGIFVDAYGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAVARHLVDPTAPGYAELPWYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTLIELQKGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKLAAAV 406
               SCOP domains d2yvjp1 P:6-115,P:237-308 NADH-dependent ferredoxin reductase, BphA4                                          d2yvjp2 P:116-236 NADH-dependent ferredoxin reductase, BphA4                                                             d2yvjp1 P:6-115,P:237-308 NADH-dependent ferredoxin reductase, BphA4    d2yvjp3 P:309-406 NADH-dependent ferredoxin reductase, BphA4                                       SCOP domains
               CATH domains 2yvjP01 P:6-110,P:239-317  [code=3.50.50.60, no name defined]                                            ---2yvjP02 P:114-236  [code=3.50.50.60, no name defined]                                                                      --2yvjP01 P:6-110,P:239-317  [code=3.50.50.60, no name defined]                  2yvjP03 P:318-406  [code=3.30.390.30, no name defined]                                    CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------------------------------------------------------------------Pyr_redox-2yvjP01 P:147-223                                                  --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------------------------------------------------------------------Pyr_redox-2yvjP02 P:147-223                                                  --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ---Pyr_redox_2-2yvjP03 P:9-279                                                                                                                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ---Pyr_redox_2-2yvjP04 P:9-279                                                                                                                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author ....eeee..hhhhhhhhhhhhhhh....eeeee........hhhhhhhhhh..hhhhhh.........eeee...eeeee....eeee....eee..eeee...eee..hhhhh...........hhhhhhhhh........eee..hhhhhhhhhhhhhhh....eee..........hhhhhhhhhhhhhh.....ee........................ee....eee.hhhhhhhh......ee...........eee....eeeee....eee...hhhhhhhhhhhhhhhhhh..........eeeeee..eeeeeee.....eeeeeee......eeeeeeee..eeeeeeee.hhhhhhhhhhhhhhh...hhhhhhh...hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2yvj P   6 LKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFERSVTGSVDGVVLLDDGTRIAADMVVVGIGVLANDALARAAGLACDDGIFVDAYGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAVARHLVDPTAPGYAELPWYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTLIELQKGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKLAAAV 406
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 7)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 5)

Asymmetric/Biological Unit

(-) Gene Ontology  (10, 12)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,P   (Q52437_PSES1 | Q52437)
molecular function
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005623    cell    The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

Chain B   (BPHA3_PSES1 | Q52440)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0019439    aromatic compound catabolic process    The chemical reactions and pathways resulting in the breakdown of aromatic compounds, any substance containing an aromatic carbon ring.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:8 - Pro A:9   [ RasMol ]  
    Ala P:8 - Pro P:9   [ RasMol ]  
    Pro B:80 - Pro B:81   [ RasMol ]  
    Ser P:209 - Val P:210   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2yvj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BPHA3_PSES1 | Q52440
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  Q52437_PSES1 | Q52437
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.18.1.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BPHA3_PSES1 | Q52440
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q52437_PSES1 | Q52437
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BPHA3_PSES1 | Q524402e4p 2e4q
UniProtKB/TrEMBL
        Q52437_PSES1 | Q524371d7y 1f3p 2gqw 2gr0 2gr1 2gr2 2gr3 2yvf 2yvg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2YVJ)