|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2YTG) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2YTG) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2YTG) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with ZKSC5_HUMAN | Q9Y2L8 from UniProtKB/Swiss-Prot Length:839 Alignment length:121 325 335 345 355 365 375 385 395 405 415 425 435 ZKSC5_HUMAN 316 GKSRQNPSQKRDLDAITDISPKQSTHGERGHRCSDCGKFFLQASNFIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQHHSVHSGERPYGCNECG 436 SCOP domains -----------------------------------------------------d2ytga1 A:8-35 ---------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) ------------------------------------------------------------------------zf-H2C2_2-2ytg----------------------------------- Pfam domains (1) Pfam domains (2) ------------------------------------------------------------------------zf-H2C2_2-2ytg----------------------------------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_ PROSITE Transcript 1 Exon 1.8 PDB: A:1-46 (gaps) UniProt: 258-460 [INCOMPLETE] Transcript 1 2ytg A 1 GSS-----------------------GSSG-----------------------TGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKP-----------------------SG--PS----SG 46 | - - | 7 - - | 14 24 34 | - - 41| || 45 3 4 7 8 40 41| 43| 45 42 44
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2YTG) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (10, 10)|
NMR Structure(hide GO term definitions) Chain A (ZKSC5_HUMAN | Q9Y2L8)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|