![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (3, 6) |
Asymmetric Unit (5, 5)
|
(no "SS Bond" information available for 2XMM) |
(no "Cis Peptide Bond" information available for 2XMM) |
(no "SAP(SNP)/Variant" information available for 2XMM) |
(no "PROSITE Motif" information available for 2XMM) |
(no "Exon" information available for 2XMM) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:63 aligned with P73213_SYNY3 | P73213 from UniProtKB/TrEMBL Length:64 Alignment length:63 11 21 31 41 51 61 P73213_SYNY3 2 TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE 64 SCOP domains d2xmma_ A: automated matches SCOP domains CATH domains 2xmmA00 A:2-64 [code=3.30.70.100, no name defined] CATH domains Pfam domains --------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------- Transcript 2xmm A 2 TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGYEVE 64 11 21 31 41 51 61 Chain B from PDB Type:PROTEIN Length:63 aligned with P73213_SYNY3 | P73213 from UniProtKB/TrEMBL Length:64 Alignment length:63 11 21 31 41 51 61 P73213_SYNY3 2 TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE 64 SCOP domains d2xmmb_ B: automated matches SCOP domains CATH domains 2xmmB00 B:2-64 [code=3.30.70.100, no name defined] CATH domains Pfam domains (1) --HMA-2xmmB01 B:4-62 -- Pfam domains (1) Pfam domains (2) --HMA-2xmmB02 B:4-62 -- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------- Transcript 2xmm B 2 TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGYEVE 64 11 21 31 41 51 61
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (P73213_SYNY3 | P73213)
|
|
|
|
|
|
|