2WSE - JenaLib

Asymmetric Unit (208, 208)

No.	Name	Evidence	Residues	Description
001	AC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11187
002	AC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11188
003	AC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11189
004	AC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41196
005	AC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11190
006	AC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11191
007	AC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11192
008	AC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11193
009	AC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41197
010	BC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11194
011	BC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11195
012	BC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11196
013	BC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11197
014	BC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1759
015	BC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1760
016	BC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1761
017	BC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1762
018	BC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1763
019	CC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1764
020	CC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1765
021	CC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1766
022	CC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1767
023	CC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1768
024	CC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1769
025	CC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1770
026	CC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1771
027	CC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1772
028	DC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1773
029	DC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1774
030	DC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1775
031	DC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1776
032	DC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1777
033	DC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1778
034	DC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1779
035	DC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1780
036	DC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1781
037	EC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1782
038	EC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1783
039	EC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1784
040	EC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1785
041	EC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1786
042	EC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1787
043	EC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1788
044	EC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1789
045	EC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1790
046	FC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1791
047	FC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1792
048	FC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1793
049	FC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1794
050	FC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1735
051	FC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1795
052	FC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1796
053	FC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1797
054	FC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11142
055	GC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11145
056	GC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11146
057	GC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31212
058	GC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11148
059	GC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA R1055
060	GC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1798
061	GC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1736
062	GC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1737
063	GC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1738
064	HC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA I1031
065	HC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1739
066	HC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1740
067	HC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1741
068	HC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1742
069	HC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1743
070	HC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1744
071	HC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1745
072	HC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1746
073	IC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1747
074	IC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1748
075	IC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1749
076	IC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1750
077	IC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1751
078	IC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1752
079	IC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1753
080	IC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1754
081	IC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1755
082	JC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1756
083	JC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1757
084	JC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1758
085	JC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1759
086	JC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1760
087	JC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1761
088	JC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1762
089	JC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1763
090	JC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1764
091	KC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1765
092	KC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1766
093	KC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1767
094	KC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1768
095	KC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1769
096	KC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1770
097	KC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1799
098	KC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1771
099	KC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1772
100	LC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA F1155
101	LC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11241
102	LC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA G1099
103	LC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1773
104	LC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA F1156
105	LC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41198
106	LC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA F1157
107	LC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41199
108	LC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11308
109	MC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11198
110	MC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA J1043
111	MC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA L1166
112	MC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA L1167
113	MC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA L1168
114	MC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1800
115	MC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 11505
116	MC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21212
117	MC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21213
118	NC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21214
119	NC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21215
120	NC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21217
121	NC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21218
122	NC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21219
123	NC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21220
124	NC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21221
125	NC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21222
126	NC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 21223
127	OC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA J1044
128	OC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31213
129	OC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31214
130	OC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31215
131	OC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31216
132	OC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31217
133	OC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31218
134	OC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31219
135	OC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31220
136	PC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 33011
137	PC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31221
138	PC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31222
139	PC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 31224
140	PC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41200
141	PC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41201
142	PC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41202
143	PC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41203
144	PC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41204
145	QC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41205
146	QC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41206
147	QC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41207
148	QC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41208
149	QC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41209
150	QC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41210
151	QC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA 41211
152	QC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE PQN A1801
153	QC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE PQN B1774
154	RC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR A1802
155	RC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR A1803
156	RC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR B1775
157	RC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR B1776
158	RC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR B1777
159	RC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR A1804
160	RC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR A1805
161	RC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR B1778
162	RC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR A1806
163	SC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR A1807
164	SC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR B1779
165	SC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR B1780
166	SC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR B1781
167	SC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR B1782
168	SC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR L1169
169	SC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR L1170
170	SC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR I1032
171	SC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE BCR 31225
172	TC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU N1086
173	TC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A7003
174	TC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A7006
175	TC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU R1056
176	TC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU 11199
177	TC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A7009
178	TC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A7010
179	TC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU 11200
180	TC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU B1783
181	UC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A7017
182	UC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU 41212
183	UC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A7023
184	UC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A7024
185	UC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU L1171
186	UC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A1808
187	UC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU A1809
188	UC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMU 21224
189	UC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE LMG B1784
190	VC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SF4 B1785
191	VC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SF4 C1082
192	VC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SF4 C1083
193	VC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SUC B8054
194	VC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SUC B8056
195	VC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SUC F1158
196	VC7	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SUC B8062
197	VC8	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SUC 21225
198	VC9	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE SUC 31226
199	WC1	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1786
200	WC2	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1810
201	WC3	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1811
202	WC4	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA A1812
203	WC5	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1787
204	WC6	SOFTWARE	[no residue information available]	BINDING SITE FOR RESIDUE CLA B1788
205	WC7	SOFTWARE	[no residue information available]	BINDING SITE FOR CHAIN 4 OF POLYSACCHARIDE RESIDUES 4014 TO 7034
206	WC8	SOFTWARE	[no residue information available]	BINDING SITE FOR CHAIN A OF POLYSACCHARIDE RESIDUES 7026 TO 8062
207	WC9	SOFTWARE	[no residue information available]	BINDING SITE FOR CHAIN A OF POLYSACCHARIDE RESIDUES 7037 TO 7051
208	XC1	SOFTWARE	[no residue information available]	BINDING SITE FOR CHAIN K OF POLYSACCHARIDE RESIDUES 1085 TO 1086

SS Bonds (0, 0)

Cis Peptide Bonds (23, 23)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 8)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain 1 from PDB  Type:PROTEIN  Length:164
 aligned with CAB6_ARATH | Q01667 from UniProtKB/Swiss-Prot  Length:241

    Alignment length:170
                                    70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230
           CAB6_ARATH    61 SAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWH 230
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains Chloroa_b-bind-2wse101 1:17-166                                                                                                                       -------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhhhhhhh................------....................hhhhhhhhhh..hhhhhhhhh......................................hhhhhhhh.hhhhhh.................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wse 1  17 SAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYG------EWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWH 186
                                    26        36        46        56        66      | 76        86        96       106       116       126       136       146       156       166       176       186
                                                                            66     73

Chain 2 from PDB  Type:PROTEIN  Length:176
 aligned with Q41038_PEA | Q41038 from UniProtKB/TrEMBL  Length:269

    Alignment length:177
                                                                                                                                                                                          253                
                                                                                                                                                                                        252 |                
                                   103       113       123       133       143       153       163       173       183       193       203       213       223       233       243        |-|      262       
           Q41038_PEA    94 SDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFA-HLADPGHATIFAAFTPK 269
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains Chloroa_b-bind-2wse201 2:36-182                                                                                                                    ------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhh.....hhhhhhhh.....................hhhhhhhhhhhh.......................................................hhhhhhh...hhhhhhhh.hhhhhhhh................-........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wse 2  36 SDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAAHLADP-HATIFAAFTPK 211
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195    | |204       
                                                                                                                                                                                              200 |          
                                                                                                                                                                                                201

Chain 3 from PDB  Type:PROTEIN  Length:160
 aligned with C6TEX2_SOYBN | C6TEX2 from UniProtKB/TrEMBL  Length:276

    Alignment length:172
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254  
         C6TEX2_SOYBN    85 SDPEGTGGFIEPKWLAYGEIINGRYAMLGAVGAIAPEILGKAGLIPQETALPWFRTGVFPPAGTYNYWADSYTLFVFEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGLGGSGEPAYPGGPFFNPLGFGKDEKSLKDLKLKEVKNGRLAMLAILGYFVQALVTGVGPYQN 256
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains Chloroa_b-bind-2wse301 3:40-202                                                                                                                                    --------- Pfam domains
         Sec.struct. author ...........................................................------.........hhhhhhhh........hhhhh........................................------.......hhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wse 3  40 SDPEGTGGFIEPKWLAYGEIINGRYAMLGAVGAIAPEILGKAGLIPQETALPWFRTGFI------NYWADSYTLFVFEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGLGGSGEPAYPGGPFFNPLGFGKDEK------LKEVKNGRLAMLAILGYFVQALVTGVGPYQN 211
                                    49        59        69        79        89        |-     | 109       119       129       139       149       159       169    |    - |     189       199       209  
                                                                                     98    105                                                                  174    181

Chain 4 from PDB  Type:PROTEIN  Length:166
 aligned with CB24_PEA | Q9SQL2 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:167
                                    90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       
             CB24_PEA    81 LAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQ 247
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains Chloroa_b-bind-2wse401 4:30-171                                                                                                   -            ------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhhhh............hhhhh.........................hhhhhhhhhhhhhhhhhhhhhh.................................................-......hhhhh......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wse 4  30 LAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRL-MLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQ 195
                                    39        49        59        69        79        89        99       109       119       129       139       149       159 |     168       178       188       
                                                                                                                                                           159 |                                   
                                                                                                                                                             160

Chain A from PDB  Type:PROTEIN  Length:730
 aligned with PSAA_PEA | P05310 from UniProtKB/Swiss-Prot  Length:758

    Alignment length:738
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750        
             PSAA_PEA    21 LVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAGLMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWARHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAQHMYSMPPYPYLATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATASTSLTWGGGDLVAVGNKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTINDQGVVTHITAGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG 758
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -------------------PsaA_PsaB-2wseA01 A:40-752                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ------ Pfam domains
         Sec.struct. author ..............................hhhhh................hhhhhhhhhhh..hhhhhh..............hhhhhhhh...............................................hhhhhhhhh.......................hhhhhhh...hhhhhh.......hhhhhh......hhhhh...............................................................hhhhhhhhhhhhhhhhhh......--------hhhhh......................hhhhhhhhhh.......hhhhhh...........hhhhhhhhhhhh...........hhhhhhhhhh.........hhhhhhhhh.......hhhhhhhh......hhhhhhhhhh......................hhhhh...........................................hhhhhhhhhhhhhhhhhhh.............................................hhhhhhhhhhhhhhhhhhhh.................hhhhh......hhhhhhh..........................hhhhhhhhhh....hhhhhhhhhhhhhhhhh...................hhhhhh..hhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHOTOSYSTE------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2wse A  21 LVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAGLMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWARHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYR--------IKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAQHMYSMPPYPYLATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATASTSLTWGGGDLVAVGNKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTINDQGVVTHITAGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG 758
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       | -      |330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750        
                                                                                                                                                                                                                                                                                                                                   318      327

Chain B from PDB  Type:PROTEIN  Length:733
 aligned with PSAB_PEA | P05311 from UniProtKB/Swiss-Prot  Length:734

    Alignment length:733
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731   
             PSAB_PEA     2 ALRIPRFSQGIAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPFHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNNAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPSSSNHLFGTTQGAGTAILTILGGFHPQTQSLWLTDVAHHHLAIAFLFLIGGLMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGPIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDIPLSSTNGPALNAGRNIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDDFYLAVFWMLNTIGWVTFYWHWKHITLWRGNVSQFNESSTYLMGWLRDYLWLNSSQLINGITPLVCNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKFG 734
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------PsaA_PsaB-2wseB01 B:8-727                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ------- Pfam domains
         Sec.struct. author ................hhhhhh.................hhhhhhhh.....hhhhhhhhh............................................................................hhhhhhhhhhhhhh............hhhhh...............hhhhhh...................................................................................hhhhhhhhhhh.....................................hhhhhh...............hhhhhhhhhh.............................................................hhhhhh..hhhhhhhh........hhhhhhh............hhhhhhh......................................................hhhhhh....hhhhhhhhh...................................hhhhhhhhh........hhhhhh...........hhhhhhh...............hhhhhh..........hhhhhhhhh.hhhhhh.hhhhhh...hhhhhhhhhh.hhhhh.................hhhhhh........hhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHOTOSYSTE---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wse B   2 ALRIPRFSQGIAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPFHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNNAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPSSSNHLFGTTQGAGTAILTILGGFHPQTQSLWLTDVAHHHLAIAFLFLIGGLMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGPIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDIPLSSTNGPALNAGRNIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDDFYLAVFWMLNTIGWVTFYWHWKHITLWRGNVSQFNESSTYLMGWLRDYLWLNSSQLINGITPLVCNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKFG 734
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731

Chain C from PDB  Type:PROTEIN  Length:81
 aligned with PSAC_PEA | P10793 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:81
                                    10        20        30        40        50        60        70        80 
             PSAC_PEA     1 MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY  81
               SCOP domains --------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wseC00 C:1-81  [code=3.30.70.20, no name defined]                                CATH domains
           Pfam domains (1) ---------Fer4_7-2wseC01 C:10-62                               ------------------- Pfam domains (1)
           Pfam domains (2) ---------Fer4_9-2wseC02 C:10-63                                ------------------ Pfam domains (2)
         Sec.struct. author ................................................................................. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) 4FE4S_FER_2  PDB: C:1-31       -------4FE4S_FER_2  PDB: C:39-68     ------------- PROSITE (1)
                PROSITE (2) ----------4FE4S_FER_1 -------------------------4FE4S_FER_1 ---------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------- Transcript
                 2wse C   1 MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY  81
                                    10        20        30        40        50        60        70        80

Chain D from PDB  Type:PROTEIN  Length:138
 aligned with PSAD_SPIOL | P12353 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:138
                                    84        94       104       114       124       134       144       154       164       174       184       194       204        
           PSAD_SPIOL    75 ELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL 212
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains PsaD-2wseD01 D:19-155                                                                                                                    - Pfam domains
         Sec.struct. author ............................eee........................eee......................eee....................................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2wse D  19 ELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL 156
                                    28        38        48        58        68        78        88        98       108       118       128       138       148

Chain E from PDB  Type:PROTEIN  Length:65
 aligned with PSAE1_ARATH | Q9S831 from UniProtKB/Swiss-Prot  Length:143

    Alignment length:65
                                    88        98       108       118       128       138     
          PSAE1_ARATH    79 IGPKRGSKVKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEVAA 143
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains 2wseE00 E:28-92  [code=2.30.30.50, no name defined]               CATH domains
               Pfam domains --PSI_PsaE-2wseE01 E:30-91                                      - Pfam domains
         Sec.struct. author ................................................................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 2wse E  28 IGPKRGSKVKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEVAA  92
                                    37        47        57        67        77        87

Chain F from PDB  Type:PROTEIN  Length:154
 aligned with PSAF_SPIOL | P12355 from UniProtKB/Swiss-Prot  Length:231

    Alignment length:154
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227    
           PSAF_SPIOL    78 DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF 231
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wseF00 F:1-154  [code=1.10.8.110, no name defined]                                                                                                        CATH domains
               Pfam domains PSI_PsaF-2wseF01 F:1-154                                                                                                                                   Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhh....................hhhhhh....................................hhhhhhh............................................hhhhhh.....hhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wse F   1 DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF 154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain G from PDB  Type:PROTEIN  Length:95
 aligned with PSAG_SPIOL | P12357 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:95
                                    82        92       102       112       122       132       142       152       162     
           PSAG_SPIOL    73 PSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF 167
               SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wseG00 G:4-98 Chlorophyll a-b binding protein like                                             CATH domains
               Pfam domains PSI_PSAK-2wseG01 G:4-95                                                                     --- Pfam domains
         Sec.struct. author ..hhhhhh........................................................hhhhhh......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------PHOTOSYSTEM_I_PSAG---------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                 2wse G   4 PSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF  98
                                    13        23        33        43        53        63        73        83        93

Chain H from PDB  Type:PROTEIN  Length:69
 aligned with PSAH_SPIOL | P22179 from UniProtKB/Swiss-Prot  Length:144

    Alignment length:69
                                    68        78        88        98       108       118         
           PSAH_SPIOL    59 DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP 127
               SCOP domains --------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------2wseH01 H:49-71        ------- CATH domains
               Pfam domains PSI_PsaH-2wseH01 H:10-78                                              Pfam domains
         Sec.struct. author ..................................................................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                 2wse H  10 DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP  78
                                    19        29        39        49        59        69

Chain I from PDB  Type:PROTEIN  Length:30
 aligned with PSAI_PEA | P17227 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:30
                                    10        20        30
             PSAI_PEA     1 MINLPSLFVPLVGLLFPAVAMASLFLHVEK  30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ---PSI_8-2wseI01 I:4-28     -- Pfam domains
         Sec.struct. author .............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 2wse I   1 MINLPSLFVPLVGLLFPAVAMASLFLHVEK  30
                                    10        20        30

Chain J from PDB  Type:PROTEIN  Length:42
 aligned with PSAJ_SPIOL | P17230 from UniProtKB/Swiss-Prot  Length:44

    Alignment length:42
                                    10        20        30        40  
           PSAJ_SPIOL     1 MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF  42
               SCOP domains ------------------------------------------ SCOP domains
               CATH domains 2wseJ00 J:1-42 Single helix bin            CATH domains
               Pfam domains PSI_PsaJ-2wseJ01 J:1-37              ----- Pfam domains
         Sec.struct. author .............hhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------ PROSITE
                 Transcript ------------------------------------------ Transcript
                 2wse J   1 MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF  42
                                    10        20        30        40

Chain K from PDB  Type:PROTEIN  Length:84
 aligned with PSAK_HORVU | P36886 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:84
                                    52        62        72        82        92       102       112       122    
           PSAK_HORVU    43 DYIGSSTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARESGLQTGDPAGFTLADTLACGAVGHIMGVGIVLGLKNTGVL 126
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2wseK00 K:1-84 Chlorophyll a-b binding protein like                                  CATH domains
               Pfam domains ---PSI_PSAK-2wseK01 K:4-84                                                           Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhh.................................hhhhhhhhh..................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------PHOTOSYSTEM_I_PSAG------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------ Transcript
                 2wse K   1 DYIGSSTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARESGIQTGDPAGFTLADTLACGAVGHIMGVGIVLGLKNTGVL  84
                                    10        20        30        40        50        60        70        80

Chain L from PDB  Type:PROTEIN  Length:161
 aligned with PSAL_SPIOL | Q41385 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:161
                                    62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212 
           PSAL_SPIOL    53 KPTYQVIQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEYAGAAGSLAAAGLVVILSMCLTMYGIASFKEGEPSIAPALTLTGRKKQPDQLQSADGWAKFTGGFFFGGVSGVTWACFLMYVLDLPY 213
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wseL00 L:5-165  [code=1.20.1240.10, no name defined]                                                                                                             CATH domains
               Pfam domains ---PsaL-2wseL01 L:8-165                                                                                                                                           Pfam domains
         Sec.struct. author ......................................................................................hhhhhh......................................................hhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wse L   5 KPTYQVIQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEYAGAAGSLAAAGLVVILSMCLTMYGIASFKEGEPSIAPALTLTGRKKQPDQLQSADGWAKFTGGFFFGGVSGVTWACFLMYVLDLPY 165
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164

Chain N from PDB  Type:PROTEIN  Length:85
 aligned with Q84U30_PHAVU | Q84U30 from UniProtKB/TrEMBL  Length:170

    Alignment length:85
                                    95       105       115       125       135       145       155       165     
         Q84U30_PHAVU    86 GVIEEYLEKSKTNKELNDKKRLATTGANFARAYTVEFGSCKFPENFTGCQDLAKQKKVPFLSDDLDLECEGKDKYKCGSNVFWKW 170
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wseN00 N:1-85 Chlorophyll A-B binding protein                                        CATH domains
               Pfam domains PsaN-2wseN01 N:1-85                                                                   Pfam domains
         Sec.struct. author ..................................................................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 2wse N   1 GVIEEYLEKSKTNKELNDKKRLATTGANFARAYTVEFGSCKFPENFTGCQDLAKQKKVPFLSDDLDLECEGKDKYKCGSNVFWKW  85
                                    10        20        30        40        50        60        70        80

Chain R from PDB  Type:PROTEIN  Length:53
                                                                                     
               SCOP domains ----------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhh......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                 2wse R   1 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx  53
                            ||||||||10||||||||20||||||||30||||||||40||||||||50|||
                            1-UNK|||10-UNK|||19-UNK|||28-UNK|||37-UNK|||46-UNK|||
                             2-UNK|||11-UNK|||20-UNK|||29-UNK|||38-UNK|||47-UNK||
                              3-UNK|| 12-UNK|| 21-UNK|| 30-UNK|| 39-UNK|| 48-UNK|
                               4-UNK|  13-UNK|  22-UNK|  31-UNK|  40-UNK|  49-UNK
                                5-UNK   14-UNK   23-UNK   32-UNK   41-UNK   50-UNK
                                 6-UNK   15-UNK   24-UNK   33-UNK   42-UNK   51-UNK
                                  7-UNK   16-UNK   25-UNK   34-UNK   43-UNK   52-UNK
                                   8-UNK   17-UNK   26-UNK   35-UNK   44-UNK   53-UNK
                                    9-UNK   18-UNK   27-UNK   36-UNK   45-UNK

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (8, 9)

Pfam Domains (16, 18)

Gene Ontology (36, 190)

Asymmetric/Biological Unit(hide GO term definitions)

Chain 1 (CAB6_ARATH | Q01667)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0031409	pigment binding	Interacting selectively and non-covalently with a pigment, any general or particular coloring matter in living organisms, e.g. melanin.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0009765	photosynthesis, light harvesting	Absorption and transfer of the energy absorbed from light photons between photosystem reaction centers.
	GO:0009768	photosynthesis, light harvesting in photosystem I	After a photon of light is absorbed by one of the many chlorophyll molecules, in one of the light-harvesting complexes of an antenna on photosystem I, some of the absorbed energy is transferred to the pair of chlorophyll molecules in the reaction center.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
	GO:0009637	response to blue light	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a blue light stimulus. Blue light is electromagnetic radiation with a wavelength of between 440 and 500nm.
	GO:0009409	response to cold	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cold stimulus, a temperature stimulus below the optimal temperature for that organism.
	GO:0010218	response to far red light	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of far red light stimulus. Far red light is electromagnetic radiation of wavelength 700-800nm. An example of this response is seen at the beginning of many plant species developmental stages. These include germination, and the point when cotyledon expansion is triggered. In certain species these processes take place in response to absorption of red light by the pigment molecule phytochrome, but the signal can be reversed by exposure to far red light. During the initial phase the phytochrome molecule is only present in the red light absorbing form, but on absorption of red light it changes to a far red light absorbing form, triggering progress through development. An immediate short period of exposure to far red light entirely returns the pigment to its initial state and prevents triggering of the developmental process. A thirty minute break between red and subsequent far red light exposure renders the red light effect irreversible, and development then occurs regardless of whether far red light exposure subsequently occurs.
	GO:0009644	response to high light intensity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a high light intensity stimulus.
	GO:0009645	response to low light intensity stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a low light intensity stimulus. Low light intensity is defined as a level of electromagnetic radiation at or below 0.1 micromols/m2.
	GO:0010114	response to red light	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a red light stimulus. Red light is electromagnetic radiation of wavelength of 580-700nm. An example of this response is seen at the beginning of many plant species developmental stages. These include germination, and the point when cotyledon expansion is triggered. In certain species these processes take place in response to absorption of red light by the pigment molecule phytochrome, but the signal can be reversed by exposure to far red light. During the initial phase the phytochrome molecule is only present in the red light absorbing form, but on absorption of red light it changes to a far red light absorbing form, triggering progress through development. An immediate short period of exposure to far red light entirely returns the pigment to its initial state and prevents triggering of the developmental process. A thirty minute break between red and subsequent far red light exposure renders the red light effect irreversible, and development then occurs regardless of whether far red light exposure subsequently occurs.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009941	chloroplast envelope	The double lipid bilayer enclosing the chloroplast and separating its contents from the rest of the cytoplasm; includes the intermembrane space.
	GO:0009534	chloroplast thylakoid	Sac-like membranous structures (cisternae) in a chloroplast combined into stacks (grana) and present singly in the stroma (stroma thylakoids or frets) as interconnections between grana. An example of this component is found in Arabidopsis thaliana.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0010287	plastoglobule	A lipoprotein particle present in chloroplasts. They are rich in non-polar lipids (triglycerides, esters) as well as in prenylquinones, plastoquinone and tocopherols. Plastoglobules are often associated with thylakoid membranes, suggesting an exchange of lipids with thylakoids.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain 2 (Q41038_PEA | Q41038)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0009765	photosynthesis, light harvesting	Absorption and transfer of the energy absorbed from light photons between photosystem reaction centers.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain 3 (C6TEX2_SOYBN | C6TEX2)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0009765	photosynthesis, light harvesting	Absorption and transfer of the energy absorbed from light photons between photosystem reaction centers.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain 4 (CB24_PEA | Q9SQL2)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0009765	photosynthesis, light harvesting	Absorption and transfer of the energy absorbed from light photons between photosystem reaction centers.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain A (PSAA_PEA | P05310)

molecular function
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain B (PSAB_PEA | P05311)

molecular function
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain C (PSAC_PEA | P10793)

molecular function
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0009773	photosynthetic electron transport in photosystem I	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, X) through a chain of electron transport molecules in the thylakoid membrane until they reach ferredoxin which passes the electron to the ultimate electron acceptor; NADP.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain D (PSAD_SPIOL | P12353)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009538	photosystem I reaction center	A photochemical system containing P700, the chlorophyll a dimer that functions as a primary electron donor. Functioning as a light-dependent plastocyanin-ferredoxin oxidoreductase, it transfers electrons from plastocyanin to ferredoxin.
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain E (PSAE1_ARATH | Q9S831)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0009735	response to cytokinin	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokinin stimulus.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009941	chloroplast envelope	The double lipid bilayer enclosing the chloroplast and separating its contents from the rest of the cytoplasm; includes the intermembrane space.
	GO:0009534	chloroplast thylakoid	Sac-like membranous structures (cisternae) in a chloroplast combined into stacks (grana) and present singly in the stroma (stroma thylakoids or frets) as interconnections between grana. An example of this component is found in Arabidopsis thaliana.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009538	photosystem I reaction center	A photochemical system containing P700, the chlorophyll a dimer that functions as a primary electron donor. Functioning as a light-dependent plastocyanin-ferredoxin oxidoreductase, it transfers electrons from plastocyanin to ferredoxin.
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0010287	plastoglobule	A lipoprotein particle present in chloroplasts. They are rich in non-polar lipids (triglycerides, esters) as well as in prenylquinones, plastoquinone and tocopherols. Plastoglobules are often associated with thylakoid membranes, suggesting an exchange of lipids with thylakoids.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain F (PSAF_SPIOL | P12355)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009543	chloroplast thylakoid lumen	The cavity enclosed within the chloroplast thylakoid membrane. An example of this component is found in Arabidopsis thaliana.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009538	photosystem I reaction center	A photochemical system containing P700, the chlorophyll a dimer that functions as a primary electron donor. Functioning as a light-dependent plastocyanin-ferredoxin oxidoreductase, it transfers electrons from plastocyanin to ferredoxin.
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain G (PSAG_SPIOL | P12357)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain H (PSAH_SPIOL | P22179)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009538	photosystem I reaction center	A photochemical system containing P700, the chlorophyll a dimer that functions as a primary electron donor. Functioning as a light-dependent plastocyanin-ferredoxin oxidoreductase, it transfers electrons from plastocyanin to ferredoxin.
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain I (PSAI_PEA | P17227)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain J (PSAJ_SPIOL | P17230)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain K (PSAK_HORVU | P36886)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain L (PSAL_SPIOL | Q41385)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).
	GO:0009538	photosystem I reaction center	A photochemical system containing P700, the chlorophyll a dimer that functions as a primary electron donor. Functioning as a light-dependent plastocyanin-ferredoxin oxidoreductase, it transfers electrons from plastocyanin to ferredoxin.
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain N (Q84U30_PHAVU | Q84U30)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0009522	photosystem I	A photosystem that contains an iron-sulfur reaction center associated with accessory pigments and electron carriers. In cyanobacteria and chloroplasts, photosystem I functions as a light-dependent plastocyanin-ferredoxin oxidoreductase, transferring electrons from plastocyanin to ferredoxin; in photosynthetic bacteria that have only a single type I photosystem, such as the green sulfur bacteria, electrons can go either to ferredoxin (Fd) -> NAD+ or to menaquinone (MK) -> Cytb/FeS -> Cytc555 -> photosystem I (cyclic photophosphorylation).

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BCR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CLA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		LMG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		LMU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PQN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SF4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SUC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UNK	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UNL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]
		CC1	[ RasMol ]	+environment [ RasMol ]
		CC2	[ RasMol ]	+environment [ RasMol ]
		CC3	[ RasMol ]	+environment [ RasMol ]
		CC4	[ RasMol ]	+environment [ RasMol ]
		CC5	[ RasMol ]	+environment [ RasMol ]
		CC6	[ RasMol ]	+environment [ RasMol ]
		CC7	[ RasMol ]	+environment [ RasMol ]
		CC8	[ RasMol ]	+environment [ RasMol ]
		CC9	[ RasMol ]	+environment [ RasMol ]
		DC1	[ RasMol ]	+environment [ RasMol ]
		DC2	[ RasMol ]	+environment [ RasMol ]
		DC3	[ RasMol ]	+environment [ RasMol ]
		DC4	[ RasMol ]	+environment [ RasMol ]
		DC5	[ RasMol ]	+environment [ RasMol ]
		DC6	[ RasMol ]	+environment [ RasMol ]
		DC7	[ RasMol ]	+environment [ RasMol ]
		DC8	[ RasMol ]	+environment [ RasMol ]
		DC9	[ RasMol ]	+environment [ RasMol ]
		EC1	[ RasMol ]	+environment [ RasMol ]
		EC2	[ RasMol ]	+environment [ RasMol ]
		EC3	[ RasMol ]	+environment [ RasMol ]
		EC4	[ RasMol ]	+environment [ RasMol ]
		EC5	[ RasMol ]	+environment [ RasMol ]
		EC6	[ RasMol ]	+environment [ RasMol ]
		EC7	[ RasMol ]	+environment [ RasMol ]
		EC8	[ RasMol ]	+environment [ RasMol ]
		EC9	[ RasMol ]	+environment [ RasMol ]
		FC1	[ RasMol ]	+environment [ RasMol ]
		FC2	[ RasMol ]	+environment [ RasMol ]
		FC3	[ RasMol ]	+environment [ RasMol ]
		FC4	[ RasMol ]	+environment [ RasMol ]
		FC5	[ RasMol ]	+environment [ RasMol ]
		FC6	[ RasMol ]	+environment [ RasMol ]
		FC7	[ RasMol ]	+environment [ RasMol ]
		FC8	[ RasMol ]	+environment [ RasMol ]
		FC9	[ RasMol ]	+environment [ RasMol ]
		GC1	[ RasMol ]	+environment [ RasMol ]
		GC2	[ RasMol ]	+environment [ RasMol ]
		GC3	[ RasMol ]	+environment [ RasMol ]
		GC4	[ RasMol ]	+environment [ RasMol ]
		GC5	[ RasMol ]	+environment [ RasMol ]
		GC6	[ RasMol ]	+environment [ RasMol ]
		GC7	[ RasMol ]	+environment [ RasMol ]
		GC8	[ RasMol ]	+environment [ RasMol ]
		GC9	[ RasMol ]	+environment [ RasMol ]
		HC1	[ RasMol ]	+environment [ RasMol ]
		HC2	[ RasMol ]	+environment [ RasMol ]
		HC3	[ RasMol ]	+environment [ RasMol ]
		HC4	[ RasMol ]	+environment [ RasMol ]
		HC5	[ RasMol ]	+environment [ RasMol ]
		HC6	[ RasMol ]	+environment [ RasMol ]
		HC7	[ RasMol ]	+environment [ RasMol ]
		HC8	[ RasMol ]	+environment [ RasMol ]
		HC9	[ RasMol ]	+environment [ RasMol ]
		IC1	[ RasMol ]	+environment [ RasMol ]
		IC2	[ RasMol ]	+environment [ RasMol ]
		IC3	[ RasMol ]	+environment [ RasMol ]
		IC4	[ RasMol ]	+environment [ RasMol ]
		IC5	[ RasMol ]	+environment [ RasMol ]
		IC6	[ RasMol ]	+environment [ RasMol ]
		IC7	[ RasMol ]	+environment [ RasMol ]
		IC8	[ RasMol ]	+environment [ RasMol ]
		IC9	[ RasMol ]	+environment [ RasMol ]
		JC1	[ RasMol ]	+environment [ RasMol ]
		JC2	[ RasMol ]	+environment [ RasMol ]
		JC3	[ RasMol ]	+environment [ RasMol ]
		JC4	[ RasMol ]	+environment [ RasMol ]
		JC5	[ RasMol ]	+environment [ RasMol ]
		JC6	[ RasMol ]	+environment [ RasMol ]
		JC7	[ RasMol ]	+environment [ RasMol ]
		JC8	[ RasMol ]	+environment [ RasMol ]
		JC9	[ RasMol ]	+environment [ RasMol ]
		KC1	[ RasMol ]	+environment [ RasMol ]
		KC2	[ RasMol ]	+environment [ RasMol ]
		KC3	[ RasMol ]	+environment [ RasMol ]
		KC4	[ RasMol ]	+environment [ RasMol ]
		KC5	[ RasMol ]	+environment [ RasMol ]
		KC6	[ RasMol ]	+environment [ RasMol ]
		KC7	[ RasMol ]	+environment [ RasMol ]
		KC8	[ RasMol ]	+environment [ RasMol ]
		KC9	[ RasMol ]	+environment [ RasMol ]
		LC1	[ RasMol ]	+environment [ RasMol ]
		LC2	[ RasMol ]	+environment [ RasMol ]
		LC3	[ RasMol ]	+environment [ RasMol ]
		LC4	[ RasMol ]	+environment [ RasMol ]
		LC5	[ RasMol ]	+environment [ RasMol ]
		LC6	[ RasMol ]	+environment [ RasMol ]
		LC7	[ RasMol ]	+environment [ RasMol ]
		LC8	[ RasMol ]	+environment [ RasMol ]
		LC9	[ RasMol ]	+environment [ RasMol ]
		MC1	[ RasMol ]	+environment [ RasMol ]
		MC2	[ RasMol ]	+environment [ RasMol ]
		MC3	[ RasMol ]	+environment [ RasMol ]
		MC4	[ RasMol ]	+environment [ RasMol ]
		MC5	[ RasMol ]	+environment [ RasMol ]
		MC6	[ RasMol ]	+environment [ RasMol ]
		MC7	[ RasMol ]	+environment [ RasMol ]
		MC8	[ RasMol ]	+environment [ RasMol ]
		MC9	[ RasMol ]	+environment [ RasMol ]
		NC1	[ RasMol ]	+environment [ RasMol ]
		NC2	[ RasMol ]	+environment [ RasMol ]
		NC3	[ RasMol ]	+environment [ RasMol ]
		NC4	[ RasMol ]	+environment [ RasMol ]
		NC5	[ RasMol ]	+environment [ RasMol ]
		NC6	[ RasMol ]	+environment [ RasMol ]
		NC7	[ RasMol ]	+environment [ RasMol ]
		NC8	[ RasMol ]	+environment [ RasMol ]
		NC9	[ RasMol ]	+environment [ RasMol ]
		OC1	[ RasMol ]	+environment [ RasMol ]
		OC2	[ RasMol ]	+environment [ RasMol ]
		OC3	[ RasMol ]	+environment [ RasMol ]
		OC4	[ RasMol ]	+environment [ RasMol ]
		OC5	[ RasMol ]	+environment [ RasMol ]
		OC6	[ RasMol ]	+environment [ RasMol ]
		OC7	[ RasMol ]	+environment [ RasMol ]
		OC8	[ RasMol ]	+environment [ RasMol ]
		OC9	[ RasMol ]	+environment [ RasMol ]
		PC1	[ RasMol ]	+environment [ RasMol ]
		PC2	[ RasMol ]	+environment [ RasMol ]
		PC3	[ RasMol ]	+environment [ RasMol ]
		PC4	[ RasMol ]	+environment [ RasMol ]
		PC5	[ RasMol ]	+environment [ RasMol ]
		PC6	[ RasMol ]	+environment [ RasMol ]
		PC7	[ RasMol ]	+environment [ RasMol ]
		PC8	[ RasMol ]	+environment [ RasMol ]
		PC9	[ RasMol ]	+environment [ RasMol ]
		QC1	[ RasMol ]	+environment [ RasMol ]
		QC2	[ RasMol ]	+environment [ RasMol ]
		QC3	[ RasMol ]	+environment [ RasMol ]
		QC4	[ RasMol ]	+environment [ RasMol ]
		QC5	[ RasMol ]	+environment [ RasMol ]
		QC6	[ RasMol ]	+environment [ RasMol ]
		QC7	[ RasMol ]	+environment [ RasMol ]
		QC8	[ RasMol ]	+environment [ RasMol ]
		QC9	[ RasMol ]	+environment [ RasMol ]
		RC1	[ RasMol ]	+environment [ RasMol ]
		RC2	[ RasMol ]	+environment [ RasMol ]
		RC3	[ RasMol ]	+environment [ RasMol ]
		RC4	[ RasMol ]	+environment [ RasMol ]
		RC5	[ RasMol ]	+environment [ RasMol ]
		RC6	[ RasMol ]	+environment [ RasMol ]
		RC7	[ RasMol ]	+environment [ RasMol ]
		RC8	[ RasMol ]	+environment [ RasMol ]
		RC9	[ RasMol ]	+environment [ RasMol ]
		SC1	[ RasMol ]	+environment [ RasMol ]
		SC2	[ RasMol ]	+environment [ RasMol ]
		SC3	[ RasMol ]	+environment [ RasMol ]
		SC4	[ RasMol ]	+environment [ RasMol ]
		SC5	[ RasMol ]	+environment [ RasMol ]
		SC6	[ RasMol ]	+environment [ RasMol ]
		SC7	[ RasMol ]	+environment [ RasMol ]
		SC8	[ RasMol ]	+environment [ RasMol ]
		SC9	[ RasMol ]	+environment [ RasMol ]
		TC1	[ RasMol ]	+environment [ RasMol ]
		TC2	[ RasMol ]	+environment [ RasMol ]
		TC3	[ RasMol ]	+environment [ RasMol ]
		TC4	[ RasMol ]	+environment [ RasMol ]
		TC5	[ RasMol ]	+environment [ RasMol ]
		TC6	[ RasMol ]	+environment [ RasMol ]
		TC7	[ RasMol ]	+environment [ RasMol ]
		TC8	[ RasMol ]	+environment [ RasMol ]
		TC9	[ RasMol ]	+environment [ RasMol ]
		UC1	[ RasMol ]	+environment [ RasMol ]
		UC2	[ RasMol ]	+environment [ RasMol ]
		UC3	[ RasMol ]	+environment [ RasMol ]
		UC4	[ RasMol ]	+environment [ RasMol ]
		UC5	[ RasMol ]	+environment [ RasMol ]
		UC6	[ RasMol ]	+environment [ RasMol ]
		UC7	[ RasMol ]	+environment [ RasMol ]
		UC8	[ RasMol ]	+environment [ RasMol ]
		UC9	[ RasMol ]	+environment [ RasMol ]
		VC1	[ RasMol ]	+environment [ RasMol ]
		VC2	[ RasMol ]	+environment [ RasMol ]
		VC3	[ RasMol ]	+environment [ RasMol ]
		VC4	[ RasMol ]	+environment [ RasMol ]
		VC5	[ RasMol ]	+environment [ RasMol ]
		VC6	[ RasMol ]	+environment [ RasMol ]
		VC7	[ RasMol ]	+environment [ RasMol ]
		VC8	[ RasMol ]	+environment [ RasMol ]
		VC9	[ RasMol ]	+environment [ RasMol ]
		WC1	[ RasMol ]	+environment [ RasMol ]
		WC2	[ RasMol ]	+environment [ RasMol ]
		WC3	[ RasMol ]	+environment [ RasMol ]
		WC4	[ RasMol ]	+environment [ RasMol ]
		WC5	[ RasMol ]	+environment [ RasMol ]
		WC6	[ RasMol ]	+environment [ RasMol ]
		WC7	[ RasMol ]	+environment [ RasMol ]
		WC8	[ RasMol ]	+environment [ RasMol ]
		WC9	[ RasMol ]	+environment [ RasMol ]
		XC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala E:91 - Ala E:92	[ RasMol ]
		Asn 2:120 - Thr 2:121	[ RasMol ]
		Asp N:63 - Asp N:64	[ RasMol ]
		Cys N:40 - Lys N:41	[ RasMol ]
		Gln N:50 - Asp N:51	[ RasMol ]
		Glu N:5 - Tyr N:6	[ RasMol ]
		Gly N:48 - Cys N:49	[ RasMol ]
		Leu L:163 - Pro L:164	[ RasMol ]
		Lys 4:74 - Trp 4:75	[ RasMol ]
		Lys N:41 - Phe N:42	[ RasMol ]
		Lys N:72 - Asp N:73	[ RasMol ]
		Lys N:84 - Trp N:85	[ RasMol ]
		Met A:316 - Tyr A:317	[ RasMol ]
		Met C:1 - Ser C:2	[ RasMol ]
		Phe N:60 - Leu N:61	[ RasMol ]
		Pro 4:34 - Glu 4:35	[ RasMol ]
		Pro L:164 - Tyr L:165	[ RasMol ]
		Ser N:79 - Asn N:80	[ RasMol ]
		Thr 4:146 - Leu 4:147	[ RasMol ]
		Tyr G:93 - Asp G:94	[ RasMol ]
		Unk R:39 - Unk R:40	[ RasMol ]
		Unk R:41 - Unk R:42	[ RasMol ]
		Val 4:194 - Gln 4:195	[ RasMol ]

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (9, 315)

Sites (208, 208)

SS Bonds (0, 0)

Cis Peptide Bonds (23, 23)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 8)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (8, 9)

Pfam Domains (16, 18)

Gene Ontology (36, 190)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File