Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE REGION 51-160 OF HUMAN KIN17 REVEALS A WINGED HELIX FOLD
 
Authors :  L. Carlier, A. Le Maire, M. Gondry, L. Guilhaudis, I. Milazzo, D. Davoust, J. Couprie, B. Gilquin, S. Zinn-Justin
Date :  27 May 07  (Deposition) - 27 Nov 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (12x)
Keywords :  Kin17, Nuclear Protein, Winged Helix Motif (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Carlier, A. Le Maire, M. Gondry, L. Guilhaudis, I. Milazzo, D. Davoust, J. Couprie, B. Gilquin, S. Zinn-Justin
Solution Structure Of The Region 51-160 Of Human Kin17 Reveals An Atypical Winged Helix Domain
Protein Sci. V. 16 2750 2007
PubMed-ID: 18029424  |  Reference-DOI: 10.1110/PS.073079107

(-) Compounds

Molecule 1 - PROTEIN KIN HOMOLOG
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PEXP-TH5
    Expression System Strain: BL21(DE3)ROSETTA PLYSS
    Expression System Taxid: 469008
    Fragment: RESIDUES 51-160
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: KIN17

 Structural Features

(-) Chains, Units

  
NMR Structure (12x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2V1N)

(-) Sites  (0, 0)

(no "Site" information available for 2V1N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2V1N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2V1N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2V1N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2V1N)

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003795621ENSE00001481660chr10:7829944-7829783162KIN17_HUMAN1-38380--
1.2ENST000003795622ENSE00001000919chr10:7825138-782504495KIN17_HUMAN39-70321A:1-2121
1.3ENST000003795623ENSE00001000917chr10:7822270-782222744KIN17_HUMAN70-85161A:21-3616
1.4ENST000003795624ENSE00001000914chr10:7822141-7822019123KIN17_HUMAN85-126421A:36-7742
1.5ENST000003795625ENSE00001000920chr10:7820982-7820801182KIN17_HUMAN126-186611A:77-11135
1.6ENST000003795626ENSE00001000913chr10:7817762-781771449KIN17_HUMAN187-203170--
1.7aENST000003795627aENSE00001000922chr10:7816854-781679461KIN17_HUMAN203-223210--
1.8ENST000003795628ENSE00001000923chr10:7811308-7811179130KIN17_HUMAN223-266440--
1.9cENST000003795629cENSE00001000912chr10:7808066-780801651KIN17_HUMAN267-283170--
1.10ENST0000037956210ENSE00001000918chr10:7805754-780568669KIN17_HUMAN284-306230--
1.11ENST0000037956211ENSE00001000911chr10:7804519-7804420100KIN17_HUMAN307-340340--
1.13ENST0000037956213ENSE00001000921chr10:7801953-7801853101KIN17_HUMAN340-373340--
1.14cENST0000037956214cENSE00001211674chr10:7798105-7797192914KIN17_HUMAN374-393200--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:111
 aligned with KIN17_HUMAN | O60870 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:111
                                    59        69        79        89        99       109       119       129       139       149       159 
          KIN17_HUMAN    50 HQRQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKK 160
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --Kin17_mid-2v1nA01 A:3-111                                                                                     Pfam domains
         Sec.struct. author ..........hhhh.hhhhhhhhhhhhhhhhhhh....eeehhhhhhhhh.......hhh.....hhhhhhhhhh...eeeeee..eeeeee.....hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:1-21--------------Exon 1.4  PDB: A:36-77 UniProt: 85-126    ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.3        ----------------------------------------Exon 1.5  PDB: A:77-111             Transcript 1 (2)
                 2v1n A   1 GQRQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKK 111
                                    10        20        30        40        50        60        70        80        90       100       110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2V1N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2V1N)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Kin17_mid] (1)

(-) Gene Ontology  (14, 14)

NMR Structure(hide GO term definitions)
Chain A   (KIN17_HUMAN | O60870)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003690    double-stranded DNA binding    Interacting selectively and non-covalently with double-stranded DNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016363    nuclear matrix    The dense fibrillar network lying on the inner side of the nuclear membrane.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2v1n)
 
  Sites
(no "Sites" information available for 2v1n)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2v1n)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2v1n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KIN17_HUMAN | O60870
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KIN17_HUMAN | O60870
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KIN17_HUMAN | O60870: 2ckk

(-) Related Entries Specified in the PDB File

2ckk HIGH RESOLUTION CRYSTAL STRUCTURE OF THE HUMAN KIN17 C-TERMINAL DOMAIN CONTAINING A KOW MOTIF