Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A DISULFIDE TRAPPED SINGLE CHAIN TRIMER COMPOSED OF THE MHC I HEAVY CHAIN H-2KB Y84C, BETA-2MICROGLOBULIN, AND OVALBUMIN-DERIVED PEPTIDE.
 
Authors :  V. E. Mitaksov, D. H. Fremont
Date :  29 Jul 07  (Deposition) - 06 Nov 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Mhc-I, Ova, Single Chain Mhc-I, Glycoprotein, Immune Response, Membrane, Mhc I, Transmembrane, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  V. Mitaksov, S. M. Truscott, L. Lybarger, J. M. Connolly, T. H. Hansen, D. H. Fremont
Structural Engineering Of Pmhc Reagents For T Cell Vaccines And Diagnostics.
Chem. Biol. V. 14 909 2007
PubMed-ID: 17719490  |  Reference-DOI: 10.1016/J.CHEMBIOL.2007.07.010
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN K-B ALPHA CHAIN, BETA-2 MICROGLOBULIN, OVALBUMIN-DERIVED PEPTIDE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET21
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentFUSION PROTEIN OF OVALBUMIN-DERIVED PEPTIDE, LINKER, BETA-2 MICROGLOBULIN, LINKER, AND H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN K-B ALPHA CHAIN EXTRACELLULAR DOMAIN
    GeneH2-K1, H2-K, B2M
    MutationYES
    Organism CommonHOUSE MOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymH-2KB

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2QRT)

(-) Sites  (0, 0)

(no "Site" information available for 2QRT)

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1A:10P-A:84H
2A:25B-A:80B
3A:101H-A:164H
4A:203H-A:259H
5B:10P-B:84H
6B:25B-B:80B
7B:101H-B:164H
8B:203H-B:259H

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1His A:31B-Pro A:32B
2Tyr A:209H-Pro A:210H
3His B:31B-Pro B:32B
4Tyr B:209H-Pro B:210H

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (6, 12)

Asymmetric Unit (6, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_B2MG_MOUSE_001 *V8IB2MG_MOUSE  ---  ---A/BG9PI
2UniProtVAR_B2MG_MOUSE_002 *H54QB2MG_MOUSE  ---  ---A/BH34BQ
3UniProtVAR_B2MG_MOUSE_003 *K64EB2MG_MOUSE  ---  ---A/BK44BE
4UniProtVAR_B2MG_MOUSE_004 *R101TB2MG_MOUSE  ---  ---A/BR81BT
5UniProtVAR_B2MG_MOUSE_005 *A105DB2MG_MOUSE  ---  ---A/BA85BD
6UniProtVAR_B2MG_MOUSE_006 *A105VB2MG_MOUSE  ---  ---A/BA85BV
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (6, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_B2MG_MOUSE_001 *V8IB2MG_MOUSE  ---  ---AG9PI
2UniProtVAR_B2MG_MOUSE_002 *H54QB2MG_MOUSE  ---  ---AH34BQ
3UniProtVAR_B2MG_MOUSE_003 *K64EB2MG_MOUSE  ---  ---AK44BE
4UniProtVAR_B2MG_MOUSE_004 *R101TB2MG_MOUSE  ---  ---AR81BT
5UniProtVAR_B2MG_MOUSE_005 *A105DB2MG_MOUSE  ---  ---AA85BD
6UniProtVAR_B2MG_MOUSE_006 *A105VB2MG_MOUSE  ---  ---AA85BV
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (6, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_B2MG_MOUSE_001 *V8IB2MG_MOUSE  ---  ---BG9PI
2UniProtVAR_B2MG_MOUSE_002 *H54QB2MG_MOUSE  ---  ---BH34BQ
3UniProtVAR_B2MG_MOUSE_003 *K64EB2MG_MOUSE  ---  ---BK44BE
4UniProtVAR_B2MG_MOUSE_004 *R101TB2MG_MOUSE  ---  ---BR81BT
5UniProtVAR_B2MG_MOUSE_005 *A105DB2MG_MOUSE  ---  ---BA85BD
6UniProtVAR_B2MG_MOUSE_006 *A105VB2MG_MOUSE  ---  ---BA85BV
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IG_MHCPS00290 Immunoglobulins and major histocompatibility complex proteins signature.B2MG_MOUSE98-104
 
  2A:78B-84B
B:78B-84B
HA1B_MOUSE278-284
 
  2A:257H-263H
B:257H-263H
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IG_MHCPS00290 Immunoglobulins and major histocompatibility complex proteins signature.B2MG_MOUSE98-104
 
  1A:78B-84B
-
HA1B_MOUSE278-284
 
  1A:257H-263H
-
Biological Unit 2 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IG_MHCPS00290 Immunoglobulins and major histocompatibility complex proteins signature.B2MG_MOUSE98-104
 
  1-
B:78B-84B
HA1B_MOUSE278-284
 
  1-
B:257H-263H

(-) Exons   (0, 0)

(no "Exon" information available for 2QRT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:398
 aligned with B2MG_MOUSE | P01887 from UniProtKB/Swiss-Prot  Length:119

    Alignment length:398
                             1           14 15                                                                                                     119                                                                                                                                                                                                                                                                                    
                             |       9    |  |17        27        37        47        57        67        77        87        97       107       117 |       -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -        
          B2MG_MOUSE      - -MARSVTLVFLVLVS--LTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------    -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -----------------------2qrtA01 A:1B-99B Immunoglobulins                                                                   2qrtA02 A:1H-181H Murine Class I Major Histocompatibility Complex, H2-DB, subunit A, domain 1                                                                                        2qrtA03 A:182H-276H Immunoglobulins                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................eeeeee.........eeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeee.......eeeeee.......eeee.......eeeeeeeeee........eeeeeeee..eeeeeee........ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeee.....eeeeeeeeee..eeeeee......eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeeeeee.....eeeeee..ee.....ee...ee.....eeeeeeeeee..hhh.eeeeee.......eee.... Sec.struct. author
             SAPs(SNPs) (1) --------I-----------------------------------------------Q---------E------------------------------------T---D-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------V-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------IG_MHC --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qrt A   1P SIINFEKLGCGASGGGGSGGGGSIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDMGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGCYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP 276H
                            |||||||10P|||||||20P||||||||7B|||||||17B|||||||27B|||||||37B|||||||47B|||||||57B|||||||67B|||||||77B|||||||87B|||||||97B||||||||8H|||||||18H|||||||28H|||||||38H|||||||48H|||||||58H|||||||68H|||||||78H|||||||88H|||||||98H||||||108H||||||118H||||||128H||||||138H||||||148H||||||158H||||||168H||||||178H||||||188H||||||198H||||||208H||||||218H||||||228H||||||238H||||||248H||||||258H||||||268H||||||||
                            |||||||9P||||||18P|||||||4B||||||13B||||||22B||||||31B||||||40B||||||49B||||||58B||||||67B||||||76B||||||85B||||||94B|||||||4H||||||13H||||||22H||||||31H||||||40H||||||49H||||||58H||||||67H||||||76H||||||85H||||||94H|||||103H|||||112H|||||121H|||||130H|||||139H|||||148H|||||157H|||||166H|||||175H|||||184H|||||193H|||||202H|||||211H|||||220H|||||229H|||||238H|||||247H|||||256H|||||265H|||||274H||
                           1P||||||10P||||||19P|||||||5B||||||14B||||||23B||||||32B||||||41B||||||50B||||||59B||||||68B||||||77B||||||86B||||||95B|||||||5H||||||14H||||||23H||||||32H||||||41H||||||50H||||||59H||||||68H||||||77H||||||86H||||||95H|||||104H|||||113H|||||122H|||||131H|||||140H|||||149H|||||158H|||||167H|||||176H|||||185H|||||194H|||||203H|||||212H|||||221H|||||230H|||||239H|||||248H|||||257H|||||266H|||||275H|
                            2P||||||11P||||||20P|||||| 6B||||||15B||||||24B||||||33B||||||42B||||||51B||||||60B||||||69B||||||78B||||||87B||||||96B|||||| 6H||||||15H||||||24H||||||33H||||||42H||||||51H||||||60H||||||69H||||||78H||||||87H||||||96H|||||105H|||||114H|||||123H|||||132H|||||141H|||||150H|||||159H|||||168H|||||177H|||||186H|||||195H|||||204H|||||213H|||||222H|||||231H|||||240H|||||249H|||||258H|||||267H|||||276H
                             3P||||| 12P||||| 21P|||||  7B||||| 16B||||| 25B||||| 34B||||| 43B||||| 52B||||| 61B||||| 70B||||| 79B||||| 88B||||| 97B|||||  7H||||| 16H||||| 25H||||| 34H||||| 43H||||| 52H||||| 61H||||| 70H||||| 79H||||| 88H||||| 97H|||||106H|||||115H|||||124H|||||133H|||||142H|||||151H|||||160H|||||169H|||||178H|||||187H|||||196H|||||205H|||||214H|||||223H|||||232H|||||241H|||||250H|||||259H|||||268H|||||   
                              4P||||  13P||||  22P||||   8B||||  17B||||  26B||||  35B||||  44B||||  53B||||  62B||||  71B||||  80B||||  89B||||  98B||||   8H||||  17H||||  26H||||  35H||||  44H||||  53H||||  62H||||  71H||||  80H||||  89H||||  98H|||| 107H|||| 116H|||| 125H|||| 134H|||| 143H|||| 152H|||| 161H|||| 170H|||| 179H|||| 188H|||| 197H|||| 206H|||| 215H|||| 224H|||| 233H|||| 242H|||| 251H|||| 260H|||| 269H||||   
                               5P|||   14P|||   23P|||    9B|||   18B|||   27B|||   36B|||   45B|||   54B|||   63B|||   72B|||   81B|||   90B|||   99B|||    9H|||   18H|||   27H|||   36H|||   45H|||   54H|||   63H|||   72H|||   81H|||   90H|||   99H|||  108H|||  117H|||  126H|||  135H|||  144H|||  153H|||  162H|||  171H|||  180H|||  189H|||  198H|||  207H|||  216H|||  225H|||  234H|||  243H|||  252H|||  261H|||  270H|||   
                                6P||    15P||     1B||    10B||    19B||    28B||    37B||    46B||    55B||    64B||    73B||    82B||    91B||     1H||    10H||    19H||    28H||    37H||    46H||    55H||    64H||    73H||    82H||    91H||   100H||   109H||   118H||   127H||   136H||   145H||   154H||   163H||   172H||   181H||   190H||   199H||   208H||   217H||   226H||   235H||   244H||   253H||   262H||   271H||   
                                 7P|     16P|      2B|     11B|     20B|     29B|     38B|     47B|     56B|     65B|     74B|     83B|     92B|      2H|     11H|     20H|     29H|     38H|     47H|     56H|     65H|     74H|     83H|     92H|    101H|    110H|    119H|    128H|    137H|    146H|    155H|    164H|    173H|    182H|    191H|    200H|    209H|    218H|    227H|    236H|    245H|    254H|    263H|    272H|   
                                  8P      17P       3B      12B      21B      30B      39B      48B      57B      66B      75B      84B      93B       3H      12H      21H      30H      39H      48H      57H      66H      75H      84H      93H     102H     111H     120H     129H     138H     147H     156H     165H     174H     183H     192H     201H     210H     219H     228H     237H     246H     255H     264H     273H   

Chain A from PDB  Type:PROTEIN  Length:398
 aligned with HA1B_MOUSE | P01901 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:398
                                                                                               1 3            4              20                     21                                                                                                                                                                                                                                                                                    
                                     -         -         -         -         -         -       | 3         -  |     11        |-         -         - |      29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289        
          HA1B_MOUSE      - -------------------------------------------------------------------MVP------------CTLLLLLAAALAPTQTR----------------------AGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP  297
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -----------------------2qrtA01 A:1B-99B Immunoglobulins                                                                   2qrtA02 A:1H-181H Murine Class I Major Histocompatibility Complex, H2-DB, subunit A, domain 1                                                                                        2qrtA03 A:182H-276H Immunoglobulins                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................eeeeee.........eeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeee.......eeeeee.......eeee.......eeeeeeeeee........eeeeeeee..eeeeeee........ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeee.....eeeeeeeeee..eeeeee......eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeeeeee.....eeeeee..ee.....ee...ee.....eeeeeeeeee..hhh.eeeeee.......eee.... Sec.struct. author
             SAPs(SNPs) (1) --------I-----------------------------------------------Q---------E------------------------------------T---D-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------V-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qrt A   1P SIINFEKLGCGASGGGGSGGGGSIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDMGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGCYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP 276H
                            |||||||10P|||||||20P||||||||7B|||||||17B|||||||27B|||||||37B|||||||47B|||||||57B|||||||67B|||||||77B|||||||87B|||||||97B||||||||8H|||||||18H|||||||28H|||||||38H|||||||48H|||||||58H|||||||68H|||||||78H|||||||88H|||||||98H||||||108H||||||118H||||||128H||||||138H||||||148H||||||158H||||||168H||||||178H||||||188H||||||198H||||||208H||||||218H||||||228H||||||238H||||||248H||||||258H||||||268H||||||||
                            |||||||9P||||||18P|||||||4B||||||13B||||||22B||||||31B||||||40B||||||49B||||||58B||||||67B||||||76B||||||85B||||||94B|||||||4H||||||13H||||||22H||||||31H||||||40H||||||49H||||||58H||||||67H||||||76H||||||85H||||||94H|||||103H|||||112H|||||121H|||||130H|||||139H|||||148H|||||157H|||||166H|||||175H|||||184H|||||193H|||||202H|||||211H|||||220H|||||229H|||||238H|||||247H|||||256H|||||265H|||||274H||
                           1P||||||10P||||||19P|||||||5B||||||14B||||||23B||||||32B||||||41B||||||50B||||||59B||||||68B||||||77B||||||86B||||||95B|||||||5H||||||14H||||||23H||||||32H||||||41H||||||50H||||||59H||||||68H||||||77H||||||86H||||||95H|||||104H|||||113H|||||122H|||||131H|||||140H|||||149H|||||158H|||||167H|||||176H|||||185H|||||194H|||||203H|||||212H|||||221H|||||230H|||||239H|||||248H|||||257H|||||266H|||||275H|
                            2P||||||11P||||||20P|||||| 6B||||||15B||||||24B||||||33B||||||42B||||||51B||||||60B||||||69B||||||78B||||||87B||||||96B|||||| 6H||||||15H||||||24H||||||33H||||||42H||||||51H||||||60H||||||69H||||||78H||||||87H||||||96H|||||105H|||||114H|||||123H|||||132H|||||141H|||||150H|||||159H|||||168H|||||177H|||||186H|||||195H|||||204H|||||213H|||||222H|||||231H|||||240H|||||249H|||||258H|||||267H|||||276H
                             3P||||| 12P||||| 21P|||||  7B||||| 16B||||| 25B||||| 34B||||| 43B||||| 52B||||| 61B||||| 70B||||| 79B||||| 88B||||| 97B|||||  7H||||| 16H||||| 25H||||| 34H||||| 43H||||| 52H||||| 61H||||| 70H||||| 79H||||| 88H||||| 97H|||||106H|||||115H|||||124H|||||133H|||||142H|||||151H|||||160H|||||169H|||||178H|||||187H|||||196H|||||205H|||||214H|||||223H|||||232H|||||241H|||||250H|||||259H|||||268H|||||   
                              4P||||  13P||||  22P||||   8B||||  17B||||  26B||||  35B||||  44B||||  53B||||  62B||||  71B||||  80B||||  89B||||  98B||||   8H||||  17H||||  26H||||  35H||||  44H||||  53H||||  62H||||  71H||||  80H||||  89H||||  98H|||| 107H|||| 116H|||| 125H|||| 134H|||| 143H|||| 152H|||| 161H|||| 170H|||| 179H|||| 188H|||| 197H|||| 206H|||| 215H|||| 224H|||| 233H|||| 242H|||| 251H|||| 260H|||| 269H||||   
                               5P|||   14P|||   23P|||    9B|||   18B|||   27B|||   36B|||   45B|||   54B|||   63B|||   72B|||   81B|||   90B|||   99B|||    9H|||   18H|||   27H|||   36H|||   45H|||   54H|||   63H|||   72H|||   81H|||   90H|||   99H|||  108H|||  117H|||  126H|||  135H|||  144H|||  153H|||  162H|||  171H|||  180H|||  189H|||  198H|||  207H|||  216H|||  225H|||  234H|||  243H|||  252H|||  261H|||  270H|||   
                                6P||    15P||     1B||    10B||    19B||    28B||    37B||    46B||    55B||    64B||    73B||    82B||    91B||     1H||    10H||    19H||    28H||    37H||    46H||    55H||    64H||    73H||    82H||    91H||   100H||   109H||   118H||   127H||   136H||   145H||   154H||   163H||   172H||   181H||   190H||   199H||   208H||   217H||   226H||   235H||   244H||   253H||   262H||   271H||   
                                 7P|     16P|      2B|     11B|     20B|     29B|     38B|     47B|     56B|     65B|     74B|     83B|     92B|      2H|     11H|     20H|     29H|     38H|     47H|     56H|     65H|     74H|     83H|     92H|    101H|    110H|    119H|    128H|    137H|    146H|    155H|    164H|    173H|    182H|    191H|    200H|    209H|    218H|    227H|    236H|    245H|    254H|    263H|    272H|   
                                  8P      17P       3B      12B      21B      30B      39B      48B      57B      66B      75B      84B      93B       3H      12H      21H      30H      39H      48H      57H      66H      75H      84H      93H     102H     111H     120H     129H     138H     147H     156H     165H     174H     183H     192H     201H     210H     219H     228H     237H     246H     255H     264H     273H   

Chain B from PDB  Type:PROTEIN  Length:398
 aligned with B2MG_MOUSE | P01887 from UniProtKB/Swiss-Prot  Length:119

    Alignment length:398
                             1           14 15                                                                                                     119                                                                                                                                                                                                                                                                                    
                             |       9    |  |17        27        37        47        57        67        77        87        97       107       117 |       -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -        
          B2MG_MOUSE      - -MARSVTLVFLVLVS--LTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------    -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -----------------------2qrtB01 B:1B-99B Immunoglobulins                                                                   2qrtB02 B:1H-181H Murine Class I Major Histocompatibility Complex, H2-DB, subunit A, domain 1                                                                                        2qrtB03 B:182H-276H Immunoglobulins                                                             CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------MHC_I-2qrtB03 B:1H-179H                                                                                                                                                            --------C1-set-2qrtB01 B:188H-271H                                                          ----- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------MHC_I-2qrtB04 B:1H-179H                                                                                                                                                            --------C1-set-2qrtB02 B:188H-271H                                                          ----- Pfam domains (2)
         Sec.struct. author ............................eeeeee.........eeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeee.......eeeeee.......eeee.......eeeeeeeeee........eeeeeeee..eeeeeee........ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeee.....eeeeeeeeee..eeeeee......eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeeee....eeeeeeeeeee.....eeeeee..ee.....ee...ee.....eeeeeeeeee..hhh.eeeeee.......eee.... Sec.struct. author
             SAPs(SNPs) (1) --------I-----------------------------------------------Q---------E------------------------------------T---D-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------V-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------IG_MHC --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qrt B   1P SIINFEKLGCGASGGGGSGGGGSIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDMGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGCYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP 276H
                            |||||||10P|||||||20P||||||||7B|||||||17B|||||||27B|||||||37B|||||||47B|||||||57B|||||||67B|||||||77B|||||||87B|||||||97B||||||||8H|||||||18H|||||||28H|||||||38H|||||||48H|||||||58H|||||||68H|||||||78H|||||||88H|||||||98H||||||108H||||||118H||||||128H||||||138H||||||148H||||||158H||||||168H||||||178H||||||188H||||||198H||||||208H||||||218H||||||228H||||||238H||||||248H||||||258H||||||268H||||||||
                            |||||||9P||||||18P|||||||4B||||||13B||||||22B||||||31B||||||40B||||||49B||||||58B||||||67B||||||76B||||||85B||||||94B|||||||4H||||||13H||||||22H||||||31H||||||40H||||||49H||||||58H||||||67H||||||76H||||||85H||||||94H|||||103H|||||112H|||||121H|||||130H|||||139H|||||148H|||||157H|||||166H|||||175H|||||184H|||||193H|||||202H|||||211H|||||220H|||||229H|||||238H|||||247H|||||256H|||||265H|||||274H||
                           1P||||||10P||||||19P|||||||5B||||||14B||||||23B||||||32B||||||41B||||||50B||||||59B||||||68B||||||77B||||||86B||||||95B|||||||5H||||||14H||||||23H||||||32H||||||41H||||||50H||||||59H||||||68H||||||77H||||||86H||||||95H|||||104H|||||113H|||||122H|||||131H|||||140H|||||149H|||||158H|||||167H|||||176H|||||185H|||||194H|||||203H|||||212H|||||221H|||||230H|||||239H|||||248H|||||257H|||||266H|||||275H|
                            2P||||||11P||||||20P|||||| 6B||||||15B||||||24B||||||33B||||||42B||||||51B||||||60B||||||69B||||||78B||||||87B||||||96B|||||| 6H||||||15H||||||24H||||||33H||||||42H||||||51H||||||60H||||||69H||||||78H||||||87H||||||96H|||||105H|||||114H|||||123H|||||132H|||||141H|||||150H|||||159H|||||168H|||||177H|||||186H|||||195H|||||204H|||||213H|||||222H|||||231H|||||240H|||||249H|||||258H|||||267H|||||276H
                             3P||||| 12P||||| 21P|||||  7B||||| 16B||||| 25B||||| 34B||||| 43B||||| 52B||||| 61B||||| 70B||||| 79B||||| 88B||||| 97B|||||  7H||||| 16H||||| 25H||||| 34H||||| 43H||||| 52H||||| 61H||||| 70H||||| 79H||||| 88H||||| 97H|||||106H|||||115H|||||124H|||||133H|||||142H|||||151H|||||160H|||||169H|||||178H|||||187H|||||196H|||||205H|||||214H|||||223H|||||232H|||||241H|||||250H|||||259H|||||268H|||||   
                              4P||||  13P||||  22P||||   8B||||  17B||||  26B||||  35B||||  44B||||  53B||||  62B||||  71B||||  80B||||  89B||||  98B||||   8H||||  17H||||  26H||||  35H||||  44H||||  53H||||  62H||||  71H||||  80H||||  89H||||  98H|||| 107H|||| 116H|||| 125H|||| 134H|||| 143H|||| 152H|||| 161H|||| 170H|||| 179H|||| 188H|||| 197H|||| 206H|||| 215H|||| 224H|||| 233H|||| 242H|||| 251H|||| 260H|||| 269H||||   
                               5P|||   14P|||   23P|||    9B|||   18B|||   27B|||   36B|||   45B|||   54B|||   63B|||   72B|||   81B|||   90B|||   99B|||    9H|||   18H|||   27H|||   36H|||   45H|||   54H|||   63H|||   72H|||   81H|||   90H|||   99H|||  108H|||  117H|||  126H|||  135H|||  144H|||  153H|||  162H|||  171H|||  180H|||  189H|||  198H|||  207H|||  216H|||  225H|||  234H|||  243H|||  252H|||  261H|||  270H|||   
                                6P||    15P||     1B||    10B||    19B||    28B||    37B||    46B||    55B||    64B||    73B||    82B||    91B||     1H||    10H||    19H||    28H||    37H||    46H||    55H||    64H||    73H||    82H||    91H||   100H||   109H||   118H||   127H||   136H||   145H||   154H||   163H||   172H||   181H||   190H||   199H||   208H||   217H||   226H||   235H||   244H||   253H||   262H||   271H||   
                                 7P|     16P|      2B|     11B|     20B|     29B|     38B|     47B|     56B|     65B|     74B|     83B|     92B|      2H|     11H|     20H|     29H|     38H|     47H|     56H|     65H|     74H|     83H|     92H|    101H|    110H|    119H|    128H|    137H|    146H|    155H|    164H|    173H|    182H|    191H|    200H|    209H|    218H|    227H|    236H|    245H|    254H|    263H|    272H|   
                                  8P      17P       3B      12B      21B      30B      39B      48B      57B      66B      75B      84B      93B       3H      12H      21H      30H      39H      48H      57H      66H      75H      84H      93H     102H     111H     120H     129H     138H     147H     156H     165H     174H     183H     192H     201H     210H     219H     228H     237H     246H     255H     264H     273H   

Chain B from PDB  Type:PROTEIN  Length:398
 aligned with HA1B_MOUSE | P01901 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:398
                                                                                               1 3            4              20                     21                                                                                                                                                                                                                                                                                    
                                     -         -         -         -         -         -       | 3         -  |     11        |-         -         - |      29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289        
          HA1B_MOUSE      - -------------------------------------------------------------------MVP------------CTLLLLLAAALAPTQTR----------------------AGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP  297
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -----------------------2qrtB01 B:1B-99B Immunoglobulins                                                                   2qrtB02 B:1H-181H Murine Class I Major Histocompatibility Complex, H2-DB, subunit A, domain 1                                                                                        2qrtB03 B:182H-276H Immunoglobulins                                                             CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------MHC_I-2qrtB03 B:1H-179H                                                                                                                                                            --------C1-set-2qrtB01 B:188H-271H                                                          ----- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------MHC_I-2qrtB04 B:1H-179H                                                                                                                                                            --------C1-set-2qrtB02 B:188H-271H                                                          ----- Pfam domains (2)
         Sec.struct. author ............................eeeeee.........eeeeeeeeee.....eeeeee..ee....ee...ee.....eeeeeeeee.......eeeeee.......eeee.......eeeeeeeeee........eeeeeeee..eeeeeee........ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeee.....eeeeeeeeee..eeeeee......eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeeee....eeeeeeeeeee.....eeeeee..ee.....ee...ee.....eeeeeeeeee..hhh.eeeeee.......eee.... Sec.struct. author
             SAPs(SNPs) (1) --------I-----------------------------------------------Q---------E------------------------------------T---D-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------V-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2qrt B   1P SIINFEKLGCGASGGGGSGGGGSIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDMGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGCYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP 276H
                            |||||||10P|||||||20P||||||||7B|||||||17B|||||||27B|||||||37B|||||||47B|||||||57B|||||||67B|||||||77B|||||||87B|||||||97B||||||||8H|||||||18H|||||||28H|||||||38H|||||||48H|||||||58H|||||||68H|||||||78H|||||||88H|||||||98H||||||108H||||||118H||||||128H||||||138H||||||148H||||||158H||||||168H||||||178H||||||188H||||||198H||||||208H||||||218H||||||228H||||||238H||||||248H||||||258H||||||268H||||||||
                            |||||||9P||||||18P|||||||4B||||||13B||||||22B||||||31B||||||40B||||||49B||||||58B||||||67B||||||76B||||||85B||||||94B|||||||4H||||||13H||||||22H||||||31H||||||40H||||||49H||||||58H||||||67H||||||76H||||||85H||||||94H|||||103H|||||112H|||||121H|||||130H|||||139H|||||148H|||||157H|||||166H|||||175H|||||184H|||||193H|||||202H|||||211H|||||220H|||||229H|||||238H|||||247H|||||256H|||||265H|||||274H||
                           1P||||||10P||||||19P|||||||5B||||||14B||||||23B||||||32B||||||41B||||||50B||||||59B||||||68B||||||77B||||||86B||||||95B|||||||5H||||||14H||||||23H||||||32H||||||41H||||||50H||||||59H||||||68H||||||77H||||||86H||||||95H|||||104H|||||113H|||||122H|||||131H|||||140H|||||149H|||||158H|||||167H|||||176H|||||185H|||||194H|||||203H|||||212H|||||221H|||||230H|||||239H|||||248H|||||257H|||||266H|||||275H|
                            2P||||||11P||||||20P|||||| 6B||||||15B||||||24B||||||33B||||||42B||||||51B||||||60B||||||69B||||||78B||||||87B||||||96B|||||| 6H||||||15H||||||24H||||||33H||||||42H||||||51H||||||60H||||||69H||||||78H||||||87H||||||96H|||||105H|||||114H|||||123H|||||132H|||||141H|||||150H|||||159H|||||168H|||||177H|||||186H|||||195H|||||204H|||||213H|||||222H|||||231H|||||240H|||||249H|||||258H|||||267H|||||276H
                             3P||||| 12P||||| 21P|||||  7B||||| 16B||||| 25B||||| 34B||||| 43B||||| 52B||||| 61B||||| 70B||||| 79B||||| 88B||||| 97B|||||  7H||||| 16H||||| 25H||||| 34H||||| 43H||||| 52H||||| 61H||||| 70H||||| 79H||||| 88H||||| 97H|||||106H|||||115H|||||124H|||||133H|||||142H|||||151H|||||160H|||||169H|||||178H|||||187H|||||196H|||||205H|||||214H|||||223H|||||232H|||||241H|||||250H|||||259H|||||268H|||||   
                              4P||||  13P||||  22P||||   8B||||  17B||||  26B||||  35B||||  44B||||  53B||||  62B||||  71B||||  80B||||  89B||||  98B||||   8H||||  17H||||  26H||||  35H||||  44H||||  53H||||  62H||||  71H||||  80H||||  89H||||  98H|||| 107H|||| 116H|||| 125H|||| 134H|||| 143H|||| 152H|||| 161H|||| 170H|||| 179H|||| 188H|||| 197H|||| 206H|||| 215H|||| 224H|||| 233H|||| 242H|||| 251H|||| 260H|||| 269H||||   
                               5P|||   14P|||   23P|||    9B|||   18B|||   27B|||   36B|||   45B|||   54B|||   63B|||   72B|||   81B|||   90B|||   99B|||    9H|||   18H|||   27H|||   36H|||   45H|||   54H|||   63H|||   72H|||   81H|||   90H|||   99H|||  108H|||  117H|||  126H|||  135H|||  144H|||  153H|||  162H|||  171H|||  180H|||  189H|||  198H|||  207H|||  216H|||  225H|||  234H|||  243H|||  252H|||  261H|||  270H|||   
                                6P||    15P||     1B||    10B||    19B||    28B||    37B||    46B||    55B||    64B||    73B||    82B||    91B||     1H||    10H||    19H||    28H||    37H||    46H||    55H||    64H||    73H||    82H||    91H||   100H||   109H||   118H||   127H||   136H||   145H||   154H||   163H||   172H||   181H||   190H||   199H||   208H||   217H||   226H||   235H||   244H||   253H||   262H||   271H||   
                                 7P|     16P|      2B|     11B|     20B|     29B|     38B|     47B|     56B|     65B|     74B|     83B|     92B|      2H|     11H|     20H|     29H|     38H|     47H|     56H|     65H|     74H|     83H|     92H|    101H|    110H|    119H|    128H|    137H|    146H|    155H|    164H|    173H|    182H|    191H|    200H|    209H|    218H|    227H|    236H|    245H|    254H|    263H|    272H|   
                                  8P      17P       3B      12B      21B      30B      39B      48B      57B      66B      75B      84B      93B       3H      12H      21H      30H      39H      48H      57H      66H      75H      84H      93H     102H     111H     120H     129H     138H     147H     156H     165H     174H     183H     192H     201H     210H     219H     228H     237H     246H     255H     264H     273H   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QRT)

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 4)

Asymmetric Unit
(-)
Clan: Ig (577)
(-)
Family: C1-set (338)
1aC1-set-2qrtB01B:188H-271H
1bC1-set-2qrtB02B:188H-271H
(-)
Clan: MHC (252)
(-)
Family: MHC_I (210)
2aMHC_I-2qrtB03B:1H-179H
2bMHC_I-2qrtB04B:1H-179H

(-) Gene Ontology  (60, 73)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (HA1B_MOUSE | P01901)
molecular function
    GO:0042608    T cell receptor binding    Interacting selectively and non-covalently with a T cell receptor, the antigen-recognizing receptor on the surface of T cells.
    GO:0046977    TAP binding    Interacting selectively and non-covalently with TAP protein, transporter associated with antigen processing protein. TAP protein is a heterodimeric peptide transporter consisting of the subunits TAP1 and TAP2.
    GO:0030881    beta-2-microglobulin binding    Interacting selectively and non-covalently with beta-2-microglobulin.
    GO:0042605    peptide antigen binding    Interacting selectively and non-covalently with an antigen peptide.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
    GO:0019882    antigen processing and presentation    The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
    GO:0002485    antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent    The process in which an antigen-presenting cell expresses a peptide antigen of endogenous origin on its cell surface in association with an MHC class I protein complex following intracellular transport via a TAP-dependent ER pathway. The peptide is typically a fragment of a larger endogenous protein which has been degraded within the cell and becomes associated with the MHC class I molecule in the ER following TAP-dependent transport from the cytosol. Class I here refers to classical class I molecules.
    GO:0042590    antigen processing and presentation of exogenous peptide antigen via MHC class I    The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class I protein complex. The peptide antigen is typically, but not always, processed from a whole protein. Class I here refers to classical class I molecules.
    GO:0002479    antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent    The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class I protein complex following intracellular transport via a TAP (transporter associated with antigen processing) pathway. The peptide is typically a fragment of a larger exogenous protein which has been degraded within the cell and is dependent on TAP transport from the cytosol to ER for association with the MHC class I molecule. Class I here refers to classical class I molecules.
    GO:0002474    antigen processing and presentation of peptide antigen via MHC class I    The process in which an antigen-presenting cell expresses a peptide antigen on its cell surface in association with an MHC class I protein complex. Class I here refers to classical class I molecules.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0048839    inner ear development    The process whose specific outcome is the progression of the inner ear over time, from its formation to the mature structure.
    GO:0010977    negative regulation of neuron projection development    Any process that decreases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0001916    positive regulation of T cell mediated cytotoxicity    Any process that activates or increases the frequency, rate or extent of T cell mediated cytotoxicity.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005797    Golgi medial cisterna    The middle Golgi cisterna (or cisternae).
    GO:0042612    MHC class I protein complex    A transmembrane protein complex composed of a MHC class I alpha chain and an invariant beta2-microglobin chain, and with or without a bound peptide antigen. Class I here refers to classical class I molecules.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0070971    endoplasmic reticulum exit site    An endoplasmic reticulum part at which COPII-coated vesicles are produced.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0071556    integral component of lumenal side of endoplasmic reticulum membrane    The component of the endoplasmic reticulum membrane consisting of the gene products that penetrate only the lumenal side of the membrane.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030670    phagocytic vesicle membrane    The lipid bilayer surrounding a phagocytic vesicle.

Chain A,B   (B2MG_MOUSE | P01887)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0033077    T cell differentiation in thymus    The process in which a precursor cell type acquires the specialized features of a T cell via a differentiation pathway dependent upon transit through the thymus.
    GO:0019731    antibacterial humoral response    An immune response against bacteria mediated through a body fluid. Examples of this process are the antibacterial humoral responses in Mus musculus and Drosophila melanogaster.
    GO:0019885    antigen processing and presentation of endogenous peptide antigen via MHC class I    The process in which an antigen-presenting cell expresses a peptide antigen of endogenous origin on its cell surface in association with an MHC class I protein complex. The peptide antigen is typically, but not always, processed from a whole protein. Class I here refers to classical class I molecules.
    GO:0002479    antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent    The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class I protein complex following intracellular transport via a TAP (transporter associated with antigen processing) pathway. The peptide is typically a fragment of a larger exogenous protein which has been degraded within the cell and is dependent on TAP transport from the cytosol to ER for association with the MHC class I molecule. Class I here refers to classical class I molecules.
    GO:0002481    antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent    The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class Ib protein complex following intracellular transport via a TAP (transporter associated with antigen processing) pathway. The peptide is typically a fragment of a larger exogenous protein which has been degraded within the cell and is dependent on TAP transport from the cytosol to ER for association with the MHC class Ib molecule. Class Ib here refers to non-classical class I molecules, such as those of the HLA-E gene family.
    GO:0002474    antigen processing and presentation of peptide antigen via MHC class I    The process in which an antigen-presenting cell expresses a peptide antigen on its cell surface in association with an MHC class I protein complex. Class I here refers to classical class I molecules.
    GO:0006968    cellular defense response    A defense response that is mediated by cells.
    GO:0071281    cellular response to iron ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron ion stimulus.
    GO:0071222    cellular response to lipopolysaccharide    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0050829    defense response to Gram-negative bacterium    Reactions triggered in response to the presence of a Gram-negative bacterium that act to protect the cell or organism.
    GO:0050830    defense response to Gram-positive bacterium    Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0055072    iron ion homeostasis    Any process involved in the maintenance of an internal steady state of iron ions within an organism or cell.
    GO:0010977    negative regulation of neuron projection development    Any process that decreases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:1900121    negative regulation of receptor binding    Any process that stops, prevents or reduces the frequency, rate or extent of a protein or other molecule binding to a receptor.
    GO:0002726    positive regulation of T cell cytokine production    Any process that activates or increases the frequency, rate, or extent of T cell cytokine production.
    GO:0001916    positive regulation of T cell mediated cytotoxicity    Any process that activates or increases the frequency, rate or extent of T cell mediated cytotoxicity.
    GO:1904434    positive regulation of ferrous iron binding    Any process that activates or increases the frequency, rate or extent of ferrous iron binding.
    GO:0032092    positive regulation of protein binding    Any process that activates or increases the frequency, rate or extent of protein binding.
    GO:1900122    positive regulation of receptor binding    Any process that activates or increases the frequency, rate or extent of a protein or other molecule binding to a receptor.
    GO:0048260    positive regulation of receptor-mediated endocytosis    Any process that activates or increases the frequency, rate or extent of receptor mediated endocytosis, the uptake of external materials by cells, utilizing receptors to ensure specificity of transport.
    GO:1904437    positive regulation of transferrin receptor binding    Any process that activates or increases the frequency, rate or extent of transferrin receptor binding.
    GO:0042026    protein refolding    The process carried out by a cell that restores the biological activity of an unfolded or misfolded protein, using helper proteins such as chaperones.
    GO:0003254    regulation of membrane depolarization    Any process that modulates the rate, frequency or extent of membrane depolarization. Membrane depolarization is the process in which membrane potential changes in the depolarizing direction from the resting potential, usually from negative to positive.
    GO:0046686    response to cadmium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0002237    response to molecule of bacterial origin    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus by molecules of bacterial origin such as peptides derived from bacterial flagellin.
    GO:0001895    retina homeostasis    A tissue homeostatic process involved in the maintenance of an internal equilibrium within the retina of the eye, including control of cellular proliferation and death and control of metabolic function.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:1990712    HFE-transferrin receptor complex    A protein complex containing at least HFE and a transferrin receptor (either TFR1/TFRC or TFR2), proposed to play a role in the sensing of transferrin-bound Fe (Fe2-Tf) on the plasma membrane to regulate hepcidin transcription.
    GO:0042612    MHC class I protein complex    A transmembrane protein complex composed of a MHC class I alpha chain and an invariant beta2-microglobin chain, and with or without a bound peptide antigen. Class I here refers to classical class I molecules.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030670    phagocytic vesicle membrane    The lipid bilayer surrounding a phagocytic vesicle.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2qrt)
 
  Sites
(no "Sites" information available for 2qrt)
 
  Cis Peptide Bonds
    His A:31B - Pro A:32B  [ RasMol ]  
    His B:31B - Pro B:32B  [ RasMol ]  
    Tyr A:209H - Pro A:210H  [ RasMol ]  
    Tyr B:209H - Pro B:210H  [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qrt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B2MG_MOUSE | P01887
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  HA1B_MOUSE | P01901
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  B2MG_MOUSE | P01887
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  HA1B_MOUSE | P01901
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        B2MG_MOUSE | P018871bii 1bqh 1bz9 1cd1 1ddh 1ffn 1ffo 1ffp 1fg2 1fo0 1fzj 1fzk 1fzm 1fzo 1g6r 1g7p 1g7q 1hoc 1inq 1jpf 1jpg 1juf 1k8d 1kbg 1kj2 1kj3 1kpu 1kpv 1l6q 1ld9 1ldp 1leg 1lek 1lk2 1mhc 1mwa 1n3n 1n59 1n5a 1nam 1nan 1nez 1osz 1p1z 1p4l 1pqz 1qo3 1rjy 1rjz 1rk0 1rk1 1s7q 1s7r 1s7s 1s7t 1s7u 1s7v 1s7w 1s7x 1t0m 1t0n 1u58 1vac 1vad 1wbx 1wby 1wbz 1yn6 1yn7 1z5l 1zhb 1zhn 1zt1 1zt7 2akr 2ckb 2clv 2clz 2fik 2fo4 2fwo 2gaz 2mha 2ol3 2q7y 2qri 2qrs 2vaa 2vab 2ve6 2zok 2zol 2zsv 2zsw 3arb 3ard 3are 3arf 3arg 3au1 3buy 3c8k 3cc5 3cch 3ch1 3cpl 3cvh 3dmm 3e6f 3e6h 3ecb 3fol 3fom 3fon 3ftg 3g08 3gml 3gmm 3gmn 3gmo 3gmp 3gmq 3gmr 3he6 3he7 3ilp 3ilq 3l3h 3ma7 3nwm 3o8x 3o9w 3p4m 3p4n 3p4o 3p9l 3p9m 3pab 3pqy 3pwu 3qi9 3quk 3qul 3qux 3quy 3quz 3rgv 3rol 3roo 3rtq 3rug 3rzc 3scm 3sda 3sdc 3sdd 3t1f 3ta3 3tbs 3tbt 3tbv 3tbw 3tby 3tn0 3to4 3tvm 3ubx 3vj6 3ws3 3ws6 4apq 4ei5 4elm 4hs3 4huu 4huv 4huw 4hux 4hv8 4iho 4irj 4irs 4l8b 4l8c 4l8d 4mng 4mq7 4mx7 4nsk 4pg2 4pg9 4pgb 4pgc 4pgd 4pge 4pv8 4pv9 4y16 4y2d 4y4f 4y4h 4y4k 4zak 4zus 4zut 4zuu 4zuv 4zuw 5e8n 5e8o 5e8p 5efi 5fkp 5ivx 5j6g 5j6h 5jwd 5jwe 5sws 5swz
        HA1B_MOUSE | P019011bqh 1fo0 1fzj 1fzk 1fzm 1fzo 1g6r 1g7p 1g7q 1kbg 1kj2 1kj3 1kpu 1kpv 1leg 1lek 1lk2 1mwa 1n59 1nam 1nan 1osz 1p1z 1p4l 1rjy 1rjz 1rk0 1rk1 1s7q 1s7r 1s7s 1s7t 1t0m 1t0n 1vac 1vad 1wbz 2ckb 2clv 2clz 2fo4 2mha 2ol3 2qri 2qrs 2vaa 2vab 2zsv 2zsw 3c8k 3cvh 3p4m 3p4n 3p4o 3p9l 3p9m 3pab 3rgv 3rol 3roo 3tid 3tie 4hkj 4hs3 4pg9 4pgb 4pgc 4pgd 4pge 4pv8 4pv9

(-) Related Entries Specified in the PDB File

2qri 2qrs