Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  TOXIC SHOCK SYNDROME TOXIN-1 AT 2.07 A RESOLUTION
 
Authors :  K. R. Acharya, A. C. Papageorgiou
Date :  27 Mar 97  (Deposition) - 12 Aug 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.07
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Staphylococcal Enterotoxin, Superantigen, Toxic Shock Syndrome Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. C. Papageorgiou, R. D. Brehm, D. D. Leonidas, H. S. Tranter, K. R. Acharya
The Refined Crystal Structure Of Toxic Shock Syndrome Toxin-1 At 2. 07 A Resolution.
J. Mol. Biol. V. 260 553 1996
PubMed-ID: 8759320  |  Reference-DOI: 10.1006/JMBI.1996.0421
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TOXIC SHOCK SYNDROME TOXIN-1
    ChainsA, B, C
    Organism ScientificSTAPHYLOCOCCUS AUREUS
    Organism Taxid1280
    StrainMN8
    SynonymTSST-1

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x)A  
Biological Unit 2 (1x) B 
Biological Unit 3 (1x)  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2QIL)

(-) Sites  (0, 0)

(no "Site" information available for 2QIL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QIL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2QIL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QIL)

(-) PROSITE Motifs  (1, 3)

Asymmetric Unit (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1STAPH_STREP_TOXIN_2PS00278 Staphyloccocal enterotoxin/Streptococcal pyrogenic exotoxin signature 2.TSST_STAAU161-184
 
 
  3A:121-144
B:121-144
C:121-144
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1STAPH_STREP_TOXIN_2PS00278 Staphyloccocal enterotoxin/Streptococcal pyrogenic exotoxin signature 2.TSST_STAAU161-184
 
 
  1A:121-144
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1STAPH_STREP_TOXIN_2PS00278 Staphyloccocal enterotoxin/Streptococcal pyrogenic exotoxin signature 2.TSST_STAAU161-184
 
 
  1-
B:121-144
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1STAPH_STREP_TOXIN_2PS00278 Staphyloccocal enterotoxin/Streptococcal pyrogenic exotoxin signature 2.TSST_STAAU161-184
 
 
  1-
-
C:121-144

(-) Exons   (0, 0)

(no "Exon" information available for 2QIL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:194
 aligned with TSST_STAAU | P06886 from UniProtKB/Swiss-Prot  Length:234

    Alignment length:194
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230    
           TSST_STAAU    41 STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN 234
               SCOP domains d2qila1 A:1-93 Toxic shock syndrome toxin-1 (TSST-1)                                         d2qila2 A:94-194 Toxic shock syndrome toxin-1 (TSST-1)                                                SCOP domains
               CATH domains 2qilA01          2qilA02 A:18-88  [code=2.40.50.110, no name defined]                   2qilA01 A:1-17,A:89-194  [code=3.10.20.120, no name defined]                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh...eee...eeeeee..eeeee.....eeeee.................eeeeeee..........eeeee................eeeee..eee..............hhhhhhhhhhhhhhh..........eeeeeeee....eeeee......hhh......hhheeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------STAPH_STREP_TOXIN_2     -------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qil A   1 STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN 194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain B from PDB  Type:PROTEIN  Length:194
 aligned with TSST_STAAU | P06886 from UniProtKB/Swiss-Prot  Length:234

    Alignment length:194
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230    
           TSST_STAAU    41 STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN 234
               SCOP domains d2qilb1 B:1-93 Toxic shock syndrome toxin-1 (TSST-1)                                         d2qilb2 B:94-194 Toxic shock syndrome toxin-1 (TSST-1)                                                SCOP domains
               CATH domains 2qilB01          2qilB02 B:18-88  [code=2.40.50.110, no name defined]                   2qilB01 B:1-17,B:89-194  [code=3.10.20.120, no name defined]                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh...eee...eeeeee..eeeee.....eeeee.................eeeeeee..........eeeee................eeeee...................hhhhhhhhhhhhhhh..........eeeeeeee....eeeee......hhh......hhheeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------STAPH_STREP_TOXIN_2     -------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qil B   1 STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN 194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

Chain C from PDB  Type:PROTEIN  Length:194
 aligned with TSST_STAAU | P06886 from UniProtKB/Swiss-Prot  Length:234

    Alignment length:194
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230    
           TSST_STAAU    41 STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN 234
               SCOP domains d2qilc1 C:1-93 Toxic shock syndrome toxin-1 (TSST-1)                                         d2qilc2 C:94-194 Toxic shock syndrome toxin-1 (TSST-1)                                                SCOP domains
               CATH domains 2qilC01          2qilC02 C:18-88  [code=2.40.50.110, no name defined]                   2qilC01 C:1-17,C:89-194  [code=3.10.20.120, no name defined]                                               CATH domains
           Pfam domains (1) ----Stap_Strp_toxin-2qilC04 C:5-91                                                         -------Stap_Strp_tox_C-2qilC01 C:99-194                                                                 Pfam domains (1)
           Pfam domains (2) ----Stap_Strp_toxin-2qilC05 C:5-91                                                         -------Stap_Strp_tox_C-2qilC02 C:99-194                                                                 Pfam domains (2)
           Pfam domains (3) ----Stap_Strp_toxin-2qilC06 C:5-91                                                         -------Stap_Strp_tox_C-2qilC03 C:99-194                                                                 Pfam domains (3)
         Sec.struct. author ...hhhhhhhhhhh...eee...eeeeee..eeeee.....eeeee.................eeeeeee..........eeeee................eeeee...................hhhhhhhhhhhhhhh..........eeeeeeee....eeeee......hhh......hhheeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------STAPH_STREP_TOXIN_2     -------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qil C   1 STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN 194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric Unit

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 6)

Asymmetric Unit

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (TSST_STAAU | P06886)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2qil)
 
  Sites
(no "Sites" information available for 2qil)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2qil)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qil
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TSST_STAAU | P06886
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TSST_STAAU | P06886
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TSST_STAAU | P068861aw7 1qil 1ts2 1ts3 1ts4 1ts5 2ij0 2tss 3tss 4ohj 4tss 5tss

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QIL)