Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE AMIDASE FROM GEOBACILLUS PALLIDUS RAPC8
 
Authors :  S. W. Kimani, B. T. Sewell, V. B. Agarkar, M. F. Sayed, D. A. Cowan
Date :  20 Apr 07  (Deposition) - 01 May 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (6x)
Keywords :  Nitrilase Fold, Alpha-Beta-Beta-Alpha, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. B. Agarkar, S. W. Kimani, D. A. Cowan, M. F. Sayed, B. T. Sewell
The Quaternary Structure Of The Amidase From Geobacillus Pallidus Rapc8 Is Revealed By Its Crystal Packing.
Acta Crystallogr. , Sect. F V. 62 1174 2006
PubMed-ID: 17142891
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ALIPHATIC AMIDASE
    Chains: A
    EC Number: 3.5.1.4
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PNH223
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PET21A
    Gene: AMIE, AMI
    Organism Scientific: GEOBACILLUS PALLIDUS
    Organism Taxid: 33936
    Strain: RAPC8
    Synonym: ACYLAMIDE AMIDOHYDROLASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (6x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2PLQ)

(-) Sites  (0, 0)

(no "Site" information available for 2PLQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PLQ)

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Ile A:79 -Pro A:80
2Thr A:103 -Gly A:104
3His A:110 -Pro A:111
4Cys A:139 -Pro A:140
5Tyr A:194 -Pro A:195

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PLQ)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CN_HYDROLASEPS50263 Carbon-nitrogen hydrolase domain profile.AMIE_BACSP13-260  1A:13-260
Biological Unit 1 (1, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CN_HYDROLASEPS50263 Carbon-nitrogen hydrolase domain profile.AMIE_BACSP13-260  6A:13-260

(-) Exons   (0, 0)

(no "Exon" information available for 2PLQ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:340
 aligned with AMIE_BACSP | Q9L543 from UniProtKB/Swiss-Prot  Length:348

    Alignment length:340
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340
           AMIE_BACSP     1 MRHGDISSSHDTVGIAVVNYKMPRLHTKAEVIENAKKIADMVVGMKQGLPGMDLVVFPEYSTMGIMYDQDEMFATAASIPGEETAIFAEACKKADTWGVFSLTGEKHEDHPNKAPYNTLVLINNKGEIVQKYRKIIPWCPIEGWYPGDTTYVTEGPKGLKISLIVCDDGNYPEIWRDCAMKGAELIVRCQGYMYPAKEQQIMMAKAMAWANNTYVAVANATGFDGVYSYFGHSAIIGFDGRTLGECGTEENGIQYAEVSISQIRDFRKNAQSQNHLFKLLHRGYTGLINSGEGDRGVAECPFDFYRTWVLDAEKARENVEKITRSTVGTAECPIQGIPNE 340
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------CN_hydrolase-2plqA01 A:15-191                                                                                                                                                    ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeeeee........hhhhhhhhhhhhhhhhhhhhhhh..eeeee...........hhhhhhhhh....hhhhhhhhhhhhhhh.eeeeeeeee..........eeeeeee.....eeeeee...................ee.hhh.eeeeee.hhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhhhh..eeeeee.eee....eee...eee.....eeee.......eeeeeeehhhhhhhhhhh...hhhhhhh..hhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------CN_HYDROLASE  PDB: A:13-260 UniProt: 13-260                                                                                                                                                                                                             -------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2plq A   1 MRHGDISSSHDTVGIAVVNYKMPRLHTKAEVIENAKKIADMVVGMKQGLPGMDLVVFPEYSTMGIMYDQDEMFATAASIPGEETAIFAEACKKADTWGVFSLTGEKHEDHPNKAPYNTLVLINNKGEIVQKYRKIIPWCPIEGWYPGDTTYVTEGPKGLKISLIVCDDGNYPEIWRDCAMKGAELIVRCQGYMYPAKEQQIMMAKAMAWANNTYVAVANATGFDGVYSYFGHSAIIGFDGRTLGECGTEENGIQYAEVSISQIRDFRKNAQSQNHLFKLLHRGYTGLINSGEGDRGVAECPFDFYRTWVLDAEKARENVEKITRSTVGTAECPIQGIPNE 340
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2PLQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2PLQ)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: no clan defined [family: CN_hydrolase] (9)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A   (AMIE_BACSP | Q9L543)
molecular function
    GO:0004040    amidase activity    Catalysis of the reaction: a monocarboxylic acid amide + H2O = a monocarboxylate + NH3.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016810    hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds    Catalysis of the hydrolysis of any carbon-nitrogen bond, C-N, with the exception of peptide bonds.
biological process
    GO:0006807    nitrogen compound metabolic process    The chemical reactions and pathways involving organic or inorganic compounds that contain nitrogen.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2plq)
 
  Sites
(no "Sites" information available for 2plq)
 
  Cis Peptide Bonds
    Cys A:139 - Pro A:140   [ RasMol ]  
    His A:110 - Pro A:111   [ RasMol ]  
    Ile A:79 - Pro A:80   [ RasMol ]  
    Thr A:103 - Gly A:104   [ RasMol ]  
    Tyr A:194 - Pro A:195   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2plq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AMIE_BACSP | Q9L543
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.1.4
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AMIE_BACSP | Q9L543
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AMIE_BACSP | Q9L543: 4gyl 4gyn 4kzf 4lf0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PLQ)