2PIP - JenaLib

Asymmetric/Biological Unit (156, 156)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
001	UniProt	VAR_009761	Q	671	R	ANDR_HUMAN	Unclassified	---	L	Q	670	R
002	UniProt	VAR_009762	P	672	H	ANDR_HUMAN	Disease (PAIS)	---	L	P	671	H
003	UniProt	VAR_009763	I	673	T	ANDR_HUMAN	Unclassified	---	L	I	672	T
004	UniProt	VAR_004688	L	678	P	ANDR_HUMAN	Disease (AIS)	137852579	L	L	677	P
005	UniProt	VAR_009764	E	682	K	ANDR_HUMAN	Disease (AIS)	---	L	E	681	K
006	UniProt	VAR_013474	P	683	T	ANDR_HUMAN	Disease (PAIS)	---	L	P	682	T
007	UniProt	VAR_009765	G	684	A	ANDR_HUMAN	Unclassified	---	L	G	683	A
008	UniProt	VAR_009766	V	685	I	ANDR_HUMAN	Disease (AIS)	---	L	V	684	I
009	UniProt	VAR_009767	C	687	R	ANDR_HUMAN	Disease (PAIS)	---	L	C	686	R
010	UniProt	VAR_009768	A	688	V	ANDR_HUMAN	Disease (PAIS)	---	L	A	687	V
011	UniProt	VAR_009769	G	689	E	ANDR_HUMAN	Disease (AIS)	---	L	G	688	E
012	UniProt	VAR_004690	D	696	H	ANDR_HUMAN	Disease (AIS)	---	L	D	695	H
013	UniProt	VAR_004691	D	696	N	ANDR_HUMAN	Disease (AIS)	---	L	D	695	N
014	UniProt	VAR_004692	D	696	V	ANDR_HUMAN	Disease (AIS)	---	L	D	695	V
015	UniProt	VAR_009771	L	701	M	ANDR_HUMAN	Disease (AIS)	---	L	L	700	M
016	UniProt	VAR_009772	L	702	F	ANDR_HUMAN	Disease (AIS)	---	L	L	701	F
017	UniProt	VAR_009773	L	702	H	ANDR_HUMAN	Unclassified	864622007	L	L	701	H
018	UniProt	VAR_009774	S	703	A	ANDR_HUMAN	Disease (AIS)	---	L	S	702	A
019	UniProt	VAR_009775	S	704	C	ANDR_HUMAN	Disease (AIS)	---	L	S	703	C
020	UniProt	VAR_004693	S	704	G	ANDR_HUMAN	Disease (AIS)	---	L	S	703	G
021	UniProt	VAR_009776	N	706	S	ANDR_HUMAN	Disease (AIS)	---	L	N	705	S
022	UniProt	VAR_013475	N	706	Y	ANDR_HUMAN	Disease (AIS)	---	L	N	705	Y
023	UniProt	VAR_004694	L	708	R	ANDR_HUMAN	Disease (AIS)	137852585	L	L	707	R
024	UniProt	VAR_009777	G	709	A	ANDR_HUMAN	Disease (PAIS)	---	L	G	708	A
025	UniProt	VAR_009778	G	709	V	ANDR_HUMAN	Disease (AIS)	---	L	G	708	V
026	UniProt	VAR_009779	R	711	T	ANDR_HUMAN	Disease (AIS)	---	L	R	710	T
027	UniProt	VAR_013476	Q	712	E	ANDR_HUMAN	Disease (PAIS)	---	L	Q	711	E
028	UniProt	VAR_009780	L	713	F	ANDR_HUMAN	Disease (PAIS)	137852595	L	L	712	F
029	UniProt	VAR_009781	V	716	M	ANDR_HUMAN	Unclassified	---	L	V	715	M
030	UniProt	VAR_009782	K	718	E	ANDR_HUMAN	Unclassified	---	L	K	717	E
031	UniProt	VAR_009783	K	721	E	ANDR_HUMAN	Unclassified	---	L	K	720	E
032	UniProt	VAR_009784	A	722	T	ANDR_HUMAN	Unclassified	137852583	L	A	721	T
033	UniProt	VAR_009785	L	723	F	ANDR_HUMAN	Disease (AIS)	---	L	L	722	F
034	UniProt	VAR_009786	P	724	S	ANDR_HUMAN	Disease (AIS)	---	L	P	723	S
035	UniProt	VAR_009787	G	725	D	ANDR_HUMAN	Unclassified	---	L	G	724	D
036	UniProt	VAR_009788	F	726	L	ANDR_HUMAN	Unclassified	---	L	F	725	L
037	UniProt	VAR_009789	R	727	L	ANDR_HUMAN	Unclassified	137852593	L	R	726	L
038	UniProt	VAR_009790	N	728	K	ANDR_HUMAN	Disease (AIS)	768869912	L	N	727	K
039	UniProt	VAR_009791	L	729	S	ANDR_HUMAN	Disease (PAIS)	---	L	L	728	S
040	UniProt	VAR_004695	V	731	M	ANDR_HUMAN	Unclassified	137852571	L	V	730	M
041	UniProt	VAR_004696	D	733	N	ANDR_HUMAN	Disease (AIS)	---	L	D	732	N
042	UniProt	VAR_004697	D	733	Y	ANDR_HUMAN	Disease (AIS)	---	L	D	732	Y
043	UniProt	VAR_009792	Q	734	H	ANDR_HUMAN	Disease (PAIS)	---	L	Q	733	H
044	UniProt	VAR_009793	I	738	T	ANDR_HUMAN	Disease (PAIS)	---	L	I	737	T
045	UniProt	VAR_009794	W	742	R	ANDR_HUMAN	Disease (AIS)	---	L	W	741	R
046	UniProt	VAR_004698	M	743	I	ANDR_HUMAN	Disease (PAIS)	---	L	M	742	I
047	UniProt	VAR_009795	M	743	V	ANDR_HUMAN	Disease (PAIS)	---	L	M	742	V
048	UniProt	VAR_013477	G	744	E	ANDR_HUMAN	Disease (AIS)	137852600	L	G	743	E
049	UniProt	VAR_004699	G	744	V	ANDR_HUMAN	Disease (AIS)	137852600	L	G	743	V
050	UniProt	VAR_009796	L	745	F	ANDR_HUMAN	Unclassified	---	L	L	744	F
051	UniProt	VAR_009797	M	746	T	ANDR_HUMAN	Disease (PAIS)	---	L	M	745	T
052	UniProt	VAR_009798	V	747	M	ANDR_HUMAN	Disease (PAIS)	---	L	V	746	M
053	UniProt	VAR_009799	A	749	D	ANDR_HUMAN	Disease (PAIS)	---	L	A	748	D
054	UniProt	VAR_009800	A	749	T	ANDR_HUMAN	Unclassified	---	L	A	748	T
055	UniProt	VAR_009801	A	749	V	ANDR_HUMAN	Unclassified	---	L	A	748	V
056	UniProt	VAR_009802	M	750	I	ANDR_HUMAN	Unclassified	---	L	M	749	I
057	UniProt	VAR_004700	M	750	V	ANDR_HUMAN	Disease (AIS)	---	L	M	749	V
058	UniProt	VAR_004701	G	751	D	ANDR_HUMAN	Disease (AIS)	---	L	G	750	D
059	UniProt	VAR_009803	G	751	S	ANDR_HUMAN	Unclassified	---	L	G	750	S
060	UniProt	VAR_009804	W	752	R	ANDR_HUMAN	Disease (AIS)	---	L	W	751	R
061	UniProt	VAR_004702	R	753	Q	ANDR_HUMAN	Disease (AIS)	---	L	R	752	Q
062	UniProt	VAR_009805	F	755	L	ANDR_HUMAN	Unclassified	---	L	F	754	L
063	UniProt	VAR_004703	F	755	V	ANDR_HUMAN	Disease (AIS)	---	L	F	754	V
064	UniProt	VAR_009806	T	756	A	ANDR_HUMAN	Unclassified	---	L	T	755	A
065	UniProt	VAR_009807	N	757	S	ANDR_HUMAN	Disease (PAIS)	141425171	L	N	756	S
066	UniProt	VAR_009808	V	758	A	ANDR_HUMAN	Unclassified	---	L	V	757	A
067	UniProt	VAR_009809	N	759	T	ANDR_HUMAN	Disease (PAIS)	---	L	N	758	T
068	UniProt	VAR_009810	S	760	F	ANDR_HUMAN	Disease (AIS)	---	L	S	759	F
069	UniProt	VAR_009811	S	760	P	ANDR_HUMAN	Unclassified	---	L	S	759	P
070	UniProt	VAR_004704	L	763	F	ANDR_HUMAN	Disease (AIS)	---	L	L	762	F
071	UniProt	VAR_004705	Y	764	C	ANDR_HUMAN	Unclassified	137852567	L	Y	763	C
072	UniProt	VAR_009812	Y	764	H	ANDR_HUMAN	Disease (AIS)	---	L	Y	763	H
073	UniProt	VAR_009813	F	765	L	ANDR_HUMAN	Disease (AIS)	---	L	F	764	L
074	UniProt	VAR_004707	A	766	T	ANDR_HUMAN	Disease (AIS)	---	L	A	765	T
075	UniProt	VAR_009814	A	766	V	ANDR_HUMAN	Disease (AIS)	---	L	A	765	V
076	UniProt	VAR_009815	P	767	S	ANDR_HUMAN	Disease (AIS)	---	L	P	766	S
077	UniProt	VAR_009816	D	768	E	ANDR_HUMAN	Disease (AIS)	---	L	D	767	E
078	UniProt	VAR_009817	L	769	P	ANDR_HUMAN	Disease (AIS)	---	L	L	768	P
079	UniProt	VAR_009818	N	772	H	ANDR_HUMAN	Disease (PAIS)	---	L	N	771	H
080	UniProt	VAR_009819	E	773	A	ANDR_HUMAN	Disease (PAIS)	---	L	E	772	A
081	UniProt	VAR_009820	E	773	G	ANDR_HUMAN	Disease (PAIS)	---	L	E	772	G
082	UniProt	VAR_004709	R	775	C	ANDR_HUMAN	Disease (AIS)	137852562	L	R	774	C
083	UniProt	VAR_004708	R	775	H	ANDR_HUMAN	Disease (AIS)	137852572	L	R	774	H
084	UniProt	VAR_004710	R	780	W	ANDR_HUMAN	Disease (AIS)	---	L	R	779	W
085	UniProt	VAR_004711	M	781	I	ANDR_HUMAN	Disease (AIS)	137852589	L	M	780	I
086	UniProt	VAR_009821	S	783	N	ANDR_HUMAN	Unclassified	---	L	S	782	N
087	UniProt	VAR_004712	C	785	Y	ANDR_HUMAN	Disease (AIS)	---	L	C	784	Y
088	UniProt	VAR_004713	M	788	V	ANDR_HUMAN	Disease (AIS)	137852570	L	M	787	V
089	UniProt	VAR_009822	R	789	S	ANDR_HUMAN	Disease (AIS)	---	L	R	788	S
090	UniProt	VAR_009823	L	791	F	ANDR_HUMAN	Disease (AIS)	---	L	L	790	F
091	UniProt	VAR_009824	S	792	P	ANDR_HUMAN	Unclassified	---	L	S	791	P
092	UniProt	VAR_009825	E	794	D	ANDR_HUMAN	Polymorphism	---	L	E	793	D
093	UniProt	VAR_004714	F	795	S	ANDR_HUMAN	Disease (AIS)	---	L	F	794	S
094	UniProt	VAR_004715	Q	799	E	ANDR_HUMAN	Unclassified	137852591	L	Q	798	E
095	UniProt	VAR_009826	C	807	Y	ANDR_HUMAN	Disease (PAIS)	---	L	C	806	Y
096	UniProt	VAR_004716	M	808	R	ANDR_HUMAN	Disease (AIS)	---	L	M	807	R
097	UniProt	VAR_009827	M	808	T	ANDR_HUMAN	Disease (PAIS)	137852592	L	M	807	T
098	UniProt	VAR_004717	M	808	V	ANDR_HUMAN	Disease (AIS)	---	L	M	807	V
099	UniProt	VAR_009828	L	813	F	ANDR_HUMAN	Disease (AIS)	---	L	L	812	F
100	UniProt	VAR_004718	S	815	N	ANDR_HUMAN	Disease (AIS)	---	L	S	814	N
101	UniProt	VAR_009829	G	821	A	ANDR_HUMAN	Disease (AIS)	---	L	G	820	A
102	UniProt	VAR_009830	L	822	V	ANDR_HUMAN	Disease (PAIS)	---	L	L	821	V
103	UniProt	VAR_013478	F	828	V	ANDR_HUMAN	Disease (PAIS)	---	L	F	827	V
104	UniProt	VAR_009831	L	831	P	ANDR_HUMAN	Unclassified	---	L	L	830	P
105	UniProt	VAR_004719	R	832	L	ANDR_HUMAN	Disease (AIS)	---	L	R	831	L
106	UniProt	VAR_004720	R	832	Q	ANDR_HUMAN	Disease (AIS)	---	L	R	831	Q
107	UniProt	VAR_009832	Y	835	C	ANDR_HUMAN	Disease (AIS)	---	L	Y	834	C
108	UniProt	VAR_004721	R	841	C	ANDR_HUMAN	Disease (AIS)	137852577	L	R	840	C
109	UniProt	VAR_004722	R	841	G	ANDR_HUMAN	Disease (PAIS)	---	L	R	840	G
110	UniProt	VAR_004723	R	841	H	ANDR_HUMAN	Disease (AIS)	9332969	L	R	840	H
111	UniProt	VAR_009229	R	841	S	ANDR_HUMAN	Disease (PAIS)	---	L	R	840	S
112	UniProt	VAR_009833	I	842	S	ANDR_HUMAN	Disease (PAIS)	---	L	I	841	S
113	UniProt	VAR_004724	I	843	T	ANDR_HUMAN	Disease (AIS)	9332970	L	I	842	T
114	UniProt	VAR_009834	R	847	G	ANDR_HUMAN	Unclassified	---	L	R	846	G
115	UniProt	VAR_009835	R	855	K	ANDR_HUMAN	Disease (PAIS)	---	L	R	854	K
116	UniProt	VAR_004725	R	856	C	ANDR_HUMAN	Disease (AIS)	---	L	R	855	C
117	UniProt	VAR_004726	R	856	H	ANDR_HUMAN	Disease (AIS)	9332971	L	R	855	H
118	UniProt	VAR_009836	F	857	L	ANDR_HUMAN	Disease (AIS)	137852598	L	F	856	L
119	UniProt	VAR_009837	L	864	R	ANDR_HUMAN	Disease (AIS)	---	L	L	863	R
120	UniProt	VAR_009838	D	865	G	ANDR_HUMAN	Disease (AIS)	---	L	D	864	G
121	UniProt	VAR_004727	D	865	N	ANDR_HUMAN	Disease (AIS)	---	L	D	864	N
122	UniProt	VAR_009839	S	866	P	ANDR_HUMAN	Disease (AIS)	137852597	L	S	865	P
123	UniProt	VAR_004728	V	867	E	ANDR_HUMAN	Disease (AIS)	---	L	V	866	E
124	UniProt	VAR_004729	V	867	L	ANDR_HUMAN	Disease (PAIS)	137852564	L	V	866	L
125	UniProt	VAR_004730	V	867	M	ANDR_HUMAN	Unclassified	137852564	L	V	866	M
126	UniProt	VAR_004731	I	870	M	ANDR_HUMAN	Disease (PAIS)	137852574	L	I	869	M
127	UniProt	VAR_009840	A	871	G	ANDR_HUMAN	Disease (PAIS)	---	L	A	870	G
128	UniProt	VAR_009841	A	871	V	ANDR_HUMAN	Disease (PAIS)	143040492	L	A	870	V
129	UniProt	VAR_009842	R	872	G	ANDR_HUMAN	Disease (AIS)	---	L	R	871	G
130	UniProt	VAR_013479	H	875	R	ANDR_HUMAN	Disease (AIS)	---	L	H	874	R
131	UniProt	VAR_009843	H	875	Y	ANDR_HUMAN	Unclassified	137852581	L	H	874	Y
132	UniProt	VAR_004732	T	878	A	ANDR_HUMAN	Unclassified	137852578	L	T	877	A
133	UniProt	VAR_009844	T	878	S	ANDR_HUMAN	Unclassified	137852580	L	T	877	S
134	UniProt	VAR_013480	D	880	Y	ANDR_HUMAN	Disease (AIS)	---	L	D	879	Y
135	UniProt	VAR_009845	L	881	Q	ANDR_HUMAN	Unclassified	---	L	L	880	Q
136	UniProt	VAR_009846	L	882	V	ANDR_HUMAN	Disease (AIS)	---	L	L	881	V
137	UniProt	VAR_009847	M	887	V	ANDR_HUMAN	Disease (AIS)	755226547	L	M	886	V
138	UniProt	VAR_009848	V	890	M	ANDR_HUMAN	Disease (AIS)	---	L	V	889	M
139	UniProt	VAR_009849	D	891	N	ANDR_HUMAN	Unclassified	---	L	D	890	N
140	UniProt	VAR_009850	F	892	L	ANDR_HUMAN	Unclassified	---	L	F	891	L
141	UniProt	VAR_004733	P	893	L	ANDR_HUMAN	Disease (AIS)	---	L	P	892	L
142	UniProt	VAR_004734	M	896	T	ANDR_HUMAN	Disease (AIS)	---	L	M	895	T
143	UniProt	VAR_009851	A	897	T	ANDR_HUMAN	Unclassified	---	L	A	896	T
144	UniProt	VAR_009852	I	899	T	ANDR_HUMAN	Disease (AIS)	---	L	I	898	T
145	UniProt	VAR_009853	Q	903	R	ANDR_HUMAN	Unclassified	137852582	L	Q	902	R
146	UniProt	VAR_009854	V	904	M	ANDR_HUMAN	Disease (PAIS)	---	L	V	903	M
147	UniProt	VAR_009855	P	905	H	ANDR_HUMAN	Disease (AIS)	---	L	P	904	H
148	UniProt	VAR_009856	P	905	S	ANDR_HUMAN	Disease (AIS)	---	L	P	904	S
149	UniProt	VAR_004735	L	908	F	ANDR_HUMAN	Disease (AIS)	---	L	L	907	F
150	UniProt	VAR_009857	G	910	E	ANDR_HUMAN	Unclassified	---	L	G	909	E
151	UniProt	VAR_009858	G	910	R	ANDR_HUMAN	Disease (PAIS)	---	L	G	909	R
152	UniProt	VAR_009859	K	911	R	ANDR_HUMAN	Unclassified	---	L	K	910	R
153	UniProt	VAR_009860	V	912	L	ANDR_HUMAN	Disease (PAIS)	---	L	V	911	L
154	UniProt	VAR_004736	P	914	S	ANDR_HUMAN	Disease (PAIS)	---	L	P	913	S
155	UniProt	VAR_009861	F	917	L	ANDR_HUMAN	Disease (AIS)	---	L	F	916	L
156	UniProt	VAR_009862	H	918	R	ANDR_HUMAN	Disease (AIS)	---	L	H	917	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (5, 5)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain L from PDB  Type:PROTEIN  Length:249
 aligned with ANDR_HUMAN | P10275 from UniProtKB/Swiss-Prot  Length:920

    Alignment length:249
                                   680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910         
           ANDR_HUMAN   671 QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT 919
               SCOP domains d2pipl_ L: Androgen receptor                                                                                                                                                                                                                              SCOP domains
               CATH domains 2pipL00 L:670-918 Retinoid X Receptor                                                                                                                                                                                                                     CATH domains
               Pfam domains ----------------Hormone_recep-2pipL01 L:686-893                                                                                                                                                                                 ------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..eee.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh..eee..... Sec.struct. author
             SAPs(SNPs) (1) RHT----P---KTAI-RVE------H----MFAC-S-RA-TEF--M-E--ETFSDLLKS-M-NH---T---RIEFTM-DIDRQ-LASATF--FCLTSEP--HA-C----WI-N-Y--VS-FP-DS---E-------YR----F-N-----AV-----V--PL--C-----CST---G-------KCL------RGPE--MGG--R--A-YQV----V--MNLL--TT-T---RMH--F-ERL-S--LR- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------N-----H-G-Y--V-----------------------Y---------VV----TVS---V----P---H-V------G-H--------------------------------T-----------------------Q--------G--------------H--------N-L---V---Y--S--------------------------S----R--------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -------------------------V----------------------------------------------------V----------------------------------------------------------V--------------------------------H-------------------------M---------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------ SAPs(SNPs) (4)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8  PDB: L:670-724 UniProt: 629-725 [INCOMPLETE] -----------------------------------------------Exon 1.10  PDB: L:772-816 UniProt: 773-817   ----------------------------------------------------Exon 1.12b  PDB: L:869-918 UniProt: 870-920        Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.9  PDB: L:724-772 UniProt: 725-773        -------------------------------------------Exon 1.11  PDB: L:816-868 UniProt: 817-869           -------------------------------------------------- Transcript 1 (2)
                 2pip L 670 QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT 918
                                   679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (55, 55)

Asymmetric/Biological Unit(hide GO term definitions)

Chain L (ANDR_HUMAN | P10275)

molecular function
	GO:0051117	ATPase binding	Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
	GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	Combining with a signal and transmitting the signal to the transcriptional machinery by interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II.
	GO:0001085	RNA polymerase II transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription factor, any protein required to initiate or regulate transcription by RNA polymerase II.
	GO:0005497	androgen binding	Interacting selectively and non-covalently with any androgen, male sex hormones.
	GO:0004882	androgen receptor activity	Combining with an androgen and transmitting the signal to the transcriptional machinery by interacting selectively and non-covalently with an androgen response element in DNA in order to modulate transcription by RNA polymerase II.
	GO:0008013	beta-catenin binding	Interacting selectively and non-covalently with the beta subunit of the catenin complex.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0005496	steroid binding	Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0030521	androgen receptor signaling pathway	Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
	GO:0016049	cell growth	The process in which a cell irreversibly increases in size over time by accretion and biosynthetic production of matter similar to that already present.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0030522	intracellular receptor signaling pathway	Any series of molecular signals initiated by a ligand binding to an receptor located within a cell.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
	GO:0045720	negative regulation of integrin biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of integrins.
	GO:0051092	positive regulation of NF-kappaB transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
	GO:0045597	positive regulation of cell differentiation	Any process that activates or increases the frequency, rate or extent of cell differentiation.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0045726	positive regulation of integrin biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of integrins.
	GO:0042327	positive regulation of phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to a molecule.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045945	positive regulation of transcription from RNA polymerase III promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase III promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0030850	prostate gland development	The process whose specific outcome is the progression of the prostate gland over time, from its formation to the mature structure. The prostate gland is a partly muscular, partly glandular body that is situated near the base of the mammalian male urethra and secretes an alkaline viscid fluid which is a major constituent of the ejaculatory fluid.
	GO:0051259	protein oligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0090003	regulation of establishment of protein localization to plasma membrane	Any process that modulates the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007548	sex differentiation	The establishment of the sex of an organism by physical differentiation.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0043401	steroid hormone mediated signaling pathway	A series of molecular signals mediated by a steroid hormone binding to a receptor.
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (156, 156)

PROSITE Motifs (0, 0)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (55, 55)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File