|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2R33) |
(no "Site" information available for 2R33) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 2R33) |
(no "PROSITE Motif" information available for 2R33) |
(no "Exon" information available for 2R33) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:55 aligned with Q4VVG2_VIGUN | Q4VVG2 from UniProtKB/TrEMBL Length:90 Alignment length:57 90 53 63 73 83 | - Q4VVG2_VIGUN 44 PCCDSCICTKSIPPQCHCTDIRLNSCHSACKSCMCTRSMPGQCRCLD---------- - SCOP domains d2r33a1 A:17-73 Bowman-Birk inhibitor, BBI SCOP domains CATH domains 2r33A00 A:17-73 CATH domains Pfam domains --------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript --------------------------------------------------------- Transcript 2r33 A 17 PCCDSCVCTKSIPPQCHCTNIRLNSCHSGCKSCLCTFS--GSCRCLDIANFCYKPCK 73 26 36 46 | -| 66 54 57 Chain B from PDB Type:PROTEIN Length:57 aligned with Q4VVG2_VIGUN | Q4VVG2 from UniProtKB/TrEMBL Length:90 Alignment length:57 90 53 63 73 83 | - Q4VVG2_VIGUN 44 PCCDSCICTKSIPPQCHCTDIRLNSCHSACKSCMCTRSMPGQCRCLD---------- - SCOP domains d2r33b_ B: automated matches SCOP domains CATH domains 2r33B00 B:17-73 CATH domains Pfam domains (1) ----------------------------Bowman-Birk_leg-2r3---------- Pfam domains (1) Pfam domains (2) ----------------------------Bowman-Birk_leg-2r3---------- Pfam domains (2) Pfam domains (3) ----------------------------Bowman-Birk_leg-2r3---------- Pfam domains (3) Pfam domains (4) ----------------------------Bowman-Birk_leg-2r3---------- Pfam domains (4) SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript --------------------------------------------------------- Transcript 2r33 B 17 PCCDSCVCTKSIPPQCHCTNIRLNSCHSGCKSCLCTFSIPGSCRCLDIANFCYKPCK 73 26 36 46 56 66
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q4VVG2_VIGUN | Q4VVG2)
|
|
|
|
|
|
|