2ONI - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CATALYTIC DOMAIN OF THE HUMAN NEDD4-LIKE E3 LIGASE

Authors :   J. R. Walker, G. V. Avvakumov, S. Xue, C. Butler-Cole, J. Weigelt, M. Sun C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, S. Dhe-Paganon, Struct Genomics Consortium (Sgc)

Date :   24 Jan 07 (Deposition) - 17 Apr 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)
Biol. Unit 2: A  (6x)
Biol. Unit 3: A  (1x)

Keywords :   Alpha And Beta Protein (A + B), E3 Ligase, Hect Domain, Ubl- Conjugation Pathway, Structural Genomics Consortium, Sgc, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. R. Walker, G. V. Avvakumov, S. Xue, C. Butler-Cole, J. Weigelt, M. Sundstrom, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, S. Dhe-Paganon
Nedd4-Like E3 Ubiquitin-Protein Ligase
To Be Published
PubMed: search

Molecule 1 - E3 UBIQUITIN-PROTEIN LIGASE NEDD4-LIKE PROTEIN
	Chains	:	A
	EC Number	:	6.3.2.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET28A-LIC-TEV
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	HECT DOMAIN (UBIQUITIN TRANSFERASE)
	Gene	:	NEDD4L, KIAA0439, NEDL3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	NEDD4-2, NEDD4.2, NEDD4-LIKE UBIQUITIN-PROTEIN LIGASE, NEURAL PRECURSOR CELL EXPRESSED, DEVELOPMENTALLY DOWN-REGULATED 4- LIKE, UBIQUITIN-PROTEIN LIGASE NEDD4-LIKE, DEVELOPMENTALLY DOWN- REGULATED GENE 4-LIKE, UBIQUITIN-PROTEIN LIGASE RSP5

		1
Asymmetric Unit	:	A
Biological Unit 1 (2x)	:	A
Biological Unit 2 (6x)	:	A
Biological Unit 3 (1x)	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 14)

No.	Name	Count	Type	Full Name
1	MSE	13	Mod. Amino Acid	SELENOMETHIONINE
2	NA	1	Ligand/Ion	SODIUM ION

Biological Unit 1 (1, 26)

No.	Name	Count	Type	Full Name
1	MSE	26	Mod. Amino Acid	SELENOMETHIONINE
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 2 (1, 78)

No.	Name	Count	Type	Full Name
1	MSE	78	Mod. Amino Acid	SELENOMETHIONINE
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 3 (1, 13)

No.	Name	Count	Type	Full Name
1	MSE	13	Mod. Amino Acid	SELENOMETHIONINE
2	NA	-1	Ligand/Ion	SODIUM ION

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	THR A:883 , TYR A:897 , THR A:921 , ASN A:924	BINDING SITE FOR RESIDUE NA A 1000

(no "SS Bond" information available for 2ONI)

(no "Cis Peptide Bond" information available for 2ONI)

Asymmetric Unit (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_077880	Y	679	C	NED4L_HUMAN	Disease (PVNH7)	879255599	A	Y	659	C
2	UniProt	VAR_077881	Q	694	H	NED4L_HUMAN	Disease (PVNH7)	879255598	A	Q	674	H
3	UniProt	VAR_077882	E	893	K	NED4L_HUMAN	Disease (PVNH7)	879255597	A	E	873	K
4	UniProt	VAR_077883	R	897	Q	NED4L_HUMAN	Disease (PVNH7)	879255596	A	R	877	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_077880	Y	679	C	NED4L_HUMAN	Disease (PVNH7)	879255599	A	Y	659	C
2	UniProt	VAR_077881	Q	694	H	NED4L_HUMAN	Disease (PVNH7)	879255598	A	Q	674	H
3	UniProt	VAR_077882	E	893	K	NED4L_HUMAN	Disease (PVNH7)	879255597	A	E	873	K
4	UniProt	VAR_077883	R	897	Q	NED4L_HUMAN	Disease (PVNH7)	879255596	A	R	877	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 24)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_077880	Y	679	C	NED4L_HUMAN	Disease (PVNH7)	879255599	A	Y	659	C
2	UniProt	VAR_077881	Q	694	H	NED4L_HUMAN	Disease (PVNH7)	879255598	A	Q	674	H
3	UniProt	VAR_077882	E	893	K	NED4L_HUMAN	Disease (PVNH7)	879255597	A	E	873	K
4	UniProt	VAR_077883	R	897	Q	NED4L_HUMAN	Disease (PVNH7)	879255596	A	R	877	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_077880	Y	679	C	NED4L_HUMAN	Disease (PVNH7)	879255599	A	Y	659	C
2	UniProt	VAR_077881	Q	694	H	NED4L_HUMAN	Disease (PVNH7)	879255598	A	Q	674	H
3	UniProt	VAR_077882	E	893	K	NED4L_HUMAN	Disease (PVNH7)	879255597	A	E	873	K
4	UniProt	VAR_077883	R	897	Q	NED4L_HUMAN	Disease (PVNH7)	879255596	A	R	877	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HECT	PS50237	HECT domain profile.	NED4L_HUMAN	640-974	1	A:620-946

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HECT	PS50237	HECT domain profile.	NED4L_HUMAN	640-974	2	A:620-946

Biological Unit 2 (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HECT	PS50237	HECT domain profile.	NED4L_HUMAN	640-974	6	A:620-946

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HECT	PS50237	HECT domain profile.	NED4L_HUMAN	640-974	1	A:620-946

Asymmetric Unit (13, 13)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000400345	1	ENSE00001683001	chr18:55711619-55711940	322	NED4L_HUMAN	1-16	16	0	-	-
1.4	ENST00000400345	4	ENSE00001648238	chr18:55833020-55833093	74	NED4L_HUMAN	17-41	25	0	-	-
1.8	ENST00000400345	8	ENSE00001615561	chr18:55912659-55912740	82	NED4L_HUMAN	41-68	28	0	-	-
1.9	ENST00000400345	9	ENSE00001662674	chr18:55916131-55916169	39	NED4L_HUMAN	69-81	13	0	-	-
1.10	ENST00000400345	10	ENSE00001795248	chr18:55919233-55919286	54	NED4L_HUMAN	82-99	18	0	-	-
1.11	ENST00000400345	11	ENSE00001721236	chr18:55983214-55983264	51	NED4L_HUMAN	100-116	17	0	-	-
1.12	ENST00000400345	12	ENSE00001691252	chr18:55989657-55989718	62	NED4L_HUMAN	117-137	21	0	-	-
1.13	ENST00000400345	13	ENSE00001159817	chr18:55990464-55990566	103	NED4L_HUMAN	137-171	35	0	-	-
1.14	ENST00000400345	14	ENSE00001159809	chr18:55992228-55992394	167	NED4L_HUMAN	172-227	56	0	-	-
1.15	ENST00000400345	15	ENSE00001159803	chr18:55996227-55996359	133	NED4L_HUMAN	227-271	45	0	-	-
1.16	ENST00000400345	16	ENSE00001159795	chr18:55997970-55998146	177	NED4L_HUMAN	272-330	59	0	-	-
1.17	ENST00000400345	17	ENSE00000807241	chr18:56001050-56001124	75	NED4L_HUMAN	331-355	25	0	-	-
1.18	ENST00000400345	18	ENSE00000914600	chr18:56002710-56002769	60	NED4L_HUMAN	356-375	20	0	-	-
1.19	ENST00000400345	19	ENSE00000914602	chr18:56008270-56008401	132	NED4L_HUMAN	376-419	44	0	-	-
1.20	ENST00000400345	20	ENSE00000807243	chr18:56008910-56009029	120	NED4L_HUMAN	420-459	40	0	-	-
1.21	ENST00000400345	21	ENSE00000669702	chr18:56010138-56010335	198	NED4L_HUMAN	460-525	66	0	-	-
1.22	ENST00000400345	22	ENSE00000914615	chr18:56016769-56016846	78	NED4L_HUMAN	526-551	26	0	-	-
1.23	ENST00000400345	23	ENSE00000914622	chr18:56018223-56018277	55	NED4L_HUMAN	552-570	19	1	A:569-573	5
1.24	ENST00000400345	24	ENSE00000807247	chr18:56024426-56024484	59	NED4L_HUMAN	570-589	20	0	-	-
1.25	ENST00000400345	25	ENSE00000914638	chr18:56031500-56031565	66	NED4L_HUMAN	590-611	22	1	A:574-591	18
1.26	ENST00000400345	26	ENSE00000807249	chr18:56033231-56033460	230	NED4L_HUMAN	612-688	77	1	A:592-668 (gaps)	77
1.27	ENST00000400345	27	ENSE00000914645	chr18:56034978-56035099	122	NED4L_HUMAN	688-729	42	1	A:668-709	42
1.28	ENST00000400345	28	ENSE00000669736	chr18:56037629-56037699	71	NED4L_HUMAN	729-752	24	1	A:709-732	24
1.29	ENST00000400345	29	ENSE00000486414	chr18:56040406-56040501	96	NED4L_HUMAN	753-784	32	1	A:733-764	32
1.30	ENST00000400345	30	ENSE00000914660	chr18:56050478-56050551	74	NED4L_HUMAN	785-809	25	1	A:765-789	25
1.31	ENST00000400345	31	ENSE00000914663	chr18:56052758-56052818	61	NED4L_HUMAN	809-829	21	1	A:789-809	21
1.32	ENST00000400345	32	ENSE00000914668	chr18:56054671-56054730	60	NED4L_HUMAN	830-849	20	1	A:810-829	20
1.33	ENST00000400345	33	ENSE00000914673	chr18:56056317-56056424	108	NED4L_HUMAN	850-885	36	1	A:830-865	36
1.34	ENST00000400345	34	ENSE00001649725	chr18:56057878-56057974	97	NED4L_HUMAN	886-918	33	1	A:866-898	33
1.35	ENST00000400345	35	ENSE00000914685	chr18:56058719-56058791	73	NED4L_HUMAN	918-942	25	1	A:898-922	25
1.36	ENST00000400345	36	ENSE00001341470	chr18:56063399-56068772	5374	NED4L_HUMAN	942-975	34	1	A:922-946	25

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:377
 aligned with NED4L_HUMAN | Q96PU5 from UniProtKB/Swiss-Prot  Length:975

    Alignment length:409
                                   567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957         
          NED4L_HUMAN   558 IHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVE 966
               SCOP domains d2oni                               a_ A: automated matches                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------HECT-2oniA01 A:649-946                                                                                                                                                                                                                                                                                     Pfam domains
         Sec.struct. author ....h-------------------------------hhhhhhhhhhhhhhh........eeeeeehhhhhhhhhhhhhhhh.hhhhhhheeeeee.-....hhhhhhhhhhhhhhhhhhhhhhh.eee.......eee..hhhhhh.hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh....hhhhhh..hhhhhhhhhhhhhh.hhhhh...eeeeee..eeeeee...hhhhh.....hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhh.eee......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhh.ee..ee...eeee........eeehhh.eeee....hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------C--------------H------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K---Q--------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------HECT  PDB: A:620-946 UniProt: 640-974                                                                                                                                                                                                                                                                                                   PROSITE
           Transcript 1 (1) Exon 1.23    -------------------Exon 1.25 [INCOMPLETE]Exon 1.26  PDB: A:592-668 (gaps) UniProt: 612-688                            ----------------------------------------Exon 1.28  PDB: A:709-73Exon 1.29  PDB: A:733-764       Exon 1.30  PDB: A:765-789--------------------Exon 1.32           Exon 1.33  PDB: A:830-865           Exon 1.34  PDB: A:866-898        -----------------------Exon 1.36  PDB: A:922-946 Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.24  PDB: -   --------------------------------------------------------------------------------------------------Exon 1.27  PDB: A:668-709 UniProt: 688-729-------------------------------------------------------------------------------Exon 1.31            ----------------------------------------------------------------------------------------Exon 1.35  PDB: A:898-922------------------------ Transcript 1 (2)
                 2oni A 569 LYFQG-------------------------------SREFKQKYDYFRKKLKKPADIPNRFEmKLHRNNIFEESYRRImSVKRPDVLKARLWIEFE-EKGLDYGGVAREWFFLLSKEmFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKmmLGKQITLNDmESVDSEYYNSLKWILENDPTELDLmFCIDEENFGQTYQVDLKPNGSEImVTNENKREYIDLVIQWRFVNRVQKQmNAFLEGFTELLPIDLIKIFDENELELLmCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLmDAEKRIRLLQFVTGTSRVPmNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLmAVE 946
                                |    -         -         -      |577       587       597  |    607       617       627     | 637       647       657       667       677       687       697       707       717||     727 |     737       747      |757       767       777|      787       797      |807       817       827    |  837       847       857       867  |    877       887  |    897       907       917       927       937     |   
                              573                             574                       600-MSE         616-MSE          633 |                 655-MSE                                                        718-MSE    729-MSE                  754-MSE                 778-MSE                   804-MSE                     832-MSE                               870-MSE             890-MSE                                              943-MSE
                                                                                                                           635                                                                                 719-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Hect, E3 ligase catalytic domain (12)

Superfamily: Hect, E3 ligase catalytic domain (12)

Family: automated matches (8)

Protein domain: automated matches (8)

Human (Homo sapiens) [TaxId: 9606] (8)

d2onia_

(no "CATH Domain" information available for 2ONI)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: HECT] (8)

Family: HECT (8)

Homo sapiens (Human) (7)

HECT-2oniA01

A:649-946

Asymmetric Unit(hide GO term definitions)

Chain A (NED4L_HUMAN | Q96PU5)

molecular function
	GO:0044325	ion channel binding	Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0019870	potassium channel inhibitor activity	Stops, prevents, or reduces the activity of a potassium channel.
	GO:0015459	potassium channel regulator activity	Modulates potassium channel activity via direct interaction interaction with a potassium channel (binding or modification).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019871	sodium channel inhibitor activity	Stops, prevents, or reduces the activity of a sodium channel.
	GO:0017080	sodium channel regulator activity	Modulates the activity of a sodium channel.
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0006883	cellular sodium ion homeostasis	Any process involved in the maintenance of an internal steady state of sodium ions at the level of a cell.
	GO:0007588	excretion	The elimination by an organism of the waste products that arise as a result of metabolic activity. These products include water, carbon dioxide (CO2), and nitrogenous compounds.
	GO:0034220	ion transmembrane transport	A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:1901380	negative regulation of potassium ion transmembrane transport	Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transport.
	GO:1901017	negative regulation of potassium ion transmembrane transporter activity	Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transporter activity.
	GO:2000009	negative regulation of protein localization to cell surface	Any process that stops, prevents, or reduces the frequency, rate or extent of protein localization to the cell surface.
	GO:1902306	negative regulation of sodium ion transmembrane transport	Any process that stops, prevents or reduces the frequency, rate or extent of sodium ion transmembrane transport.
	GO:2000650	negative regulation of sodium ion transmembrane transporter activity	Any process that stops, prevents or reduces the frequency, rate or extent of sodium ion transmembrane transporter activity.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:2001288	positive regulation of caveolin-mediated endocytosis	Any process that activates or increases the frequency, rate or extent of caveolin-mediated endocytosis.
	GO:1903861	positive regulation of dendrite extension	Any process that activates or increases the frequency, rate or extent of dendrite extension.
	GO:0045807	positive regulation of endocytosis	Any process that activates or increases the frequency, rate or extent of endocytosis.
	GO:0045732	positive regulation of protein catabolic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0070936	protein K48-linked ubiquitination	A protein ubiquitination process in which a polymer of ubiquitin, formed by linkages between lysine residues at position 48 of the ubiquitin monomers, is added to a protein. K48-linked ubiquitination targets the substrate protein for degradation.
	GO:0006513	protein monoubiquitination	Addition of a single ubiquitin group to a protein.
	GO:0000209	protein polyubiquitination	Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
	GO:0034765	regulation of ion transmembrane transport	Any process that modulates the frequency, rate or extent of the directed movement of ions from one side of a membrane to the other.
	GO:0003254	regulation of membrane depolarization	Any process that modulates the rate, frequency or extent of membrane depolarization. Membrane depolarization is the process in which membrane potential changes in the depolarizing direction from the resting potential, usually from negative to positive.
	GO:0042391	regulation of membrane potential	Any process that modulates the establishment or extent of a membrane potential, the electric potential existing across any membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
	GO:0060306	regulation of membrane repolarization	Any process that modulates the establishment or extent of a membrane potential in the polarizing direction towards the resting potential, usually from positive to negative.
	GO:1901016	regulation of potassium ion transmembrane transporter activity	Any process that modulates the frequency, rate or extent of potassium ion transmembrane transporter activity.
	GO:0042176	regulation of protein catabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0010038	response to metal ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
	GO:0006814	sodium ion transport	The directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0086005	ventricular cardiac muscle cell action potential	An action potential that occurs in a ventricular cardiac muscle cell.
	GO:0019058	viral life cycle	A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0030104	water homeostasis	Any process involved in the maintenance of an internal steady state of water within an organism or cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2oni)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2oni
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NED4L_HUMAN \| Q96PU5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	6.3.2.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	617201
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NED4L_HUMAN \| Q96PU5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	NED4L_HUMAN \| Q96PU5	:	2laj 2lb2 2lty 2mpt 2nsq 3jvz 3jw0 5hpk

2nsq	CRYSTAL STRUCTURE OF THE C2 DOMAIN OF THE HUMAN E3 UBIQUITIN-PROTEIN LIGASE NEDD4-LIKE PROTEIN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 14)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 4)

PROSITE Motifs (1, 1)

Exons (13, 13)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (47, 47)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File