2ON7 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF NAGST-1

Authors :   O. A. Asojo, M. Ngamelue, H. Homma, G. Goud, B. Zhan, P. J. Hotez

Date :   23 Jan 07 (Deposition) - 07 Aug 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,D  (1x)
Biol. Unit 2: B,C  (1x)

Keywords :   Gst; Hookworm; Necator, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   O. A. Asojo, K. Homma, M. Sedlacek, M. Ngamelue, G. N. Goud, B. Zhan, V. Deumic, O. Asojo, P. J. Hotez
X-Ray Structures Of Na-Gst-1 And Na-Gst-2 Two Glutathione S-Transferase From The Human Hookworm Necator Americanus
Bmc Struct. Biol. V. 7 42 2007
PubMed-ID: 17594497 | Reference-DOI: 10.1186/1472-6807-7-42

Molecule 1 - NA GLUTATHIONE S-TRANSFERASE 1
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Plasmid	:	PPICZAA
	Expression System Taxid	:	4922
	Organism Scientific	:	NECATOR AMERICANUS
	Organism Taxid	:	51031
	Synonym	:	NAGST-1

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A			D
Biological Unit 2 (1x)	:		B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2ON7)

(no "Site" information available for 2ON7)

Asymmetric Unit

No.	Residues
1	A:17	-	A:68
2	B:17	-	B:68
3	C:17	-	C:68
4	D:17	-	D:68

Asymmetric Unit

No.	Residues
1	Val A:51	-	Pro A:52
2	Val B:51	-	Pro B:52
3	Asp B:116	-	Val B:117
4	Glu B:118	-	Gln B:119
5	Val C:51	-	Pro C:52
6	Val D:51	-	Pro D:52

(no "SAP(SNP)/Variant" information available for 2ON7)

(no "PROSITE Motif" information available for 2ON7)

(no "Exon" information available for 2ON7)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:206
                                                                                                                                                                                                                                              
               SCOP domains d2on7a1 A:1-77 automated matches                                             d2on7a2 A:78-206 automated matches                                                                                                SCOP domains
               CATH domains 2on7A01 A:1-75,A:191-206 Glutaredoxin                                      -------------------------------------------------------------------------------------------------------------------2on7A01          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....hhhhhhhhhhhh...eeeeehhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2on7 A   1 MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF 206
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Chain B from PDB  Type:PROTEIN  Length:206
                                                                                                                                                                                                                                              
               SCOP domains d2on7b1 B:1-77 automated matches                                             d2on7b2 B:78-206 automated matches                                                                                                SCOP domains
               CATH domains 2on7B01 B:1-75,B:191-206 Glutaredoxin                                      -------------------------------------------------------------------------------------------------------------------2on7B01          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....hhhhhhhhhhhh...eeeeehhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2on7 B   1 MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF 206
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Chain C from PDB  Type:PROTEIN  Length:206
                                                                                                                                                                                                                                              
               SCOP domains d2on7c1 C:1-77 automated matches                                             d2on7c2 C:78-206 automated matches                                                                                                SCOP domains
               CATH domains 2on7C01 C:1-75,C:191-206 Glutaredoxin                                      -------------------------------------------------------------------------------------------------------------------2on7C01          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....hhhhhhhhhhhh...eeeeehhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2on7 C   1 MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF 206
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Chain D from PDB  Type:PROTEIN  Length:206
                                                                                                                                                                                                                                              
               SCOP domains d2on7d1 D:1-77 automated matches                                             d2on7d2 D:78-206 automated matches                                                                                                SCOP domains
               CATH domains 2on7D01 D:1-75,D:191-206 Glutaredoxin                                      -------------------------------------------------------------------------------------------------------------------2on7D01          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....hhhhhhhhhhh....eeeeehhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2on7 D   1 MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF 206
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: GST C-terminal domain-like (353)

Superfamily: GST C-terminal domain-like (353)

Family: automated matches (86)

Protein domain: automated matches (86)

Necator americanus [TaxId: 51031] (3)

1a	d2on7a2	A:78-206
1b	d2on7b2	B:78-206
1c	d2on7c2	C:78-206
1d	d2on7d2	D:78-206

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: automated matches (347)

Protein domain: automated matches (347)

Necator americanus [TaxId: 51031] (3)

2a	d2on7a1	A:1-77
2b	d2on7b1	B:1-77
2c	d2on7c1	C:1-77
2d	d2on7d1	D:1-77

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Necator americanus. Organism_taxid: 51031. (2)

1a	2on7A01	A:1-75,A:191-206
1b	2on7C01	C:1-75,C:191-206
1c	2on7D01	D:1-75,D:191-206
1d	2on7B01	B:1-75,B:191-206

(no "Pfam Domain" information available for 2ON7)

Asymmetric Unit(hide GO term definitions)

(no "Gene Ontology" information available for 2ON7)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2on7)

	Sites
(no "Sites" information available for 2on7)

	Cis Peptide Bonds
		Asp B:116 - Val B:117	[ RasMol ]
		Glu B:118 - Gln B:119	[ RasMol ]
		Val A:51 - Pro A:52	[ RasMol ]
		Val B:51 - Pro B:52	[ RasMol ]
		Val C:51 - Pro C:52	[ RasMol ]
		Val D:51 - Pro D:52	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2on7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT

(no "Entries Sharing at Least One Protein Chain" available for 2ON7)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File