2OL2 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HIGH RESOLUTION STRUCTURE OF NATIVE PCI IN SPACE GROUP P21

Authors :   W. Li, J. A. Huntington

Date :   18 Jan 07 (Deposition) - 13 Mar 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Serpin, Hydrolase Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. Li, T. E. Adams, M. Kjellberg, J. Stenflo, J. A. Huntington
Structure Of Native Protein C Inhibitor Provides Insight Into Its Multiple Functions.
J. Biol. Chem. V. 282 13759 2007
PubMed-ID: 17337440 | Reference-DOI: 10.1074/JBC.M701074200
(for further references see the PDB file header)

Molecule 1 - PLASMA SERINE PROTEASE INHIBITOR
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET19B
	Expression System Strain	:	ROSETTA (DE3) PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	SERPINA5, PCI, PLANH3, PROCI
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PCI, PROTEIN C INHIBITOR, SERPIN A5, PLASMINOGEN ACTIVATOR INHIBITOR 3, PAI-3, PAI3, ACROSOMAL SERINE PROTEASE INHIBITOR

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	GOL	-1	Ligand/Ion	GLYCEROL

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LEU A:37 , ALA A:40 , ALA A:41 , ASN A:45 , ILE A:46 , TYR A:293 , HOH A:664 , HOH A:735	BINDING SITE FOR RESIDUE GOL A 650

(no "SS Bond" information available for 2OL2)

(no "Cis Peptide Bond" information available for 2OL2)

Asymmetric Unit (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_007100	A	55	V	IPSP_HUMAN	Polymorphism	6118	A/B	A	36	V
2	UniProt	VAR_013081	S	64	N	IPSP_HUMAN	Polymorphism	6115	A/B	N	45	N
3	UniProt	VAR_013082	G	94	V	IPSP_HUMAN	Polymorphism	2069976	A/B	G	75	V
4	UniProt	VAR_007101	K	105	E	IPSP_HUMAN	Polymorphism	6119	A/B	K	86	E
5	UniProt	VAR_013083	L	115	P	IPSP_HUMAN	Polymorphism	2069999	A/B	L	96	P
6	UniProt	VAR_013900	P	121	A	IPSP_HUMAN	Polymorphism	6120	A/B	P	102	A
7	UniProt	VAR_013084	G	217	R	IPSP_HUMAN	Polymorphism	6114	A/B	G	198	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_007100	A	55	V	IPSP_HUMAN	Polymorphism	6118	A	A	36	V
2	UniProt	VAR_013081	S	64	N	IPSP_HUMAN	Polymorphism	6115	A	N	45	N
3	UniProt	VAR_013082	G	94	V	IPSP_HUMAN	Polymorphism	2069976	A	G	75	V
4	UniProt	VAR_007101	K	105	E	IPSP_HUMAN	Polymorphism	6119	A	K	86	E
5	UniProt	VAR_013083	L	115	P	IPSP_HUMAN	Polymorphism	2069999	A	L	96	P
6	UniProt	VAR_013900	P	121	A	IPSP_HUMAN	Polymorphism	6120	A	P	102	A
7	UniProt	VAR_013084	G	217	R	IPSP_HUMAN	Polymorphism	6114	A	G	198	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_007100	A	55	V	IPSP_HUMAN	Polymorphism	6118	B	A	36	V
2	UniProt	VAR_013081	S	64	N	IPSP_HUMAN	Polymorphism	6115	B	N	45	N
3	UniProt	VAR_013082	G	94	V	IPSP_HUMAN	Polymorphism	2069976	B	G	75	V
4	UniProt	VAR_007101	K	105	E	IPSP_HUMAN	Polymorphism	6119	B	K	86	E
5	UniProt	VAR_013083	L	115	P	IPSP_HUMAN	Polymorphism	2069999	B	L	96	P
6	UniProt	VAR_013900	P	121	A	IPSP_HUMAN	Polymorphism	6120	B	P	102	A
7	UniProt	VAR_013084	G	217	R	IPSP_HUMAN	Polymorphism	6114	B	G	198	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SERPIN	PS00284	Serpins signature.	IPSP_HUMAN	382-392	2	A:363-373 B:363-373

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SERPIN	PS00284	Serpins signature.	IPSP_HUMAN	382-392	1	A:363-373 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SERPIN	PS00284	Serpins signature.	IPSP_HUMAN	382-392	1	- B:363-373

Asymmetric Unit (4, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000329597	1	ENSE00001765110	chr14:95047731-95047827	97	IPSP_HUMAN	-	0	0	-	-
1.2	ENST00000329597	2	ENSE00001514145	chr14:95047952-95048047	96	IPSP_HUMAN	-	0	0	-	-
1.3a	ENST00000329597	3a	ENSE00001382261	chr14:95053683-95054318	636	IPSP_HUMAN	1-207	207	2	A:28-188 B:27-188	161 162
1.4	ENST00000329597	4	ENSE00001098004	chr14:95056378-95056648	271	IPSP_HUMAN	207-297	91	2	A:188-278 B:188-278	91 91
1.5	ENST00000329597	5	ENSE00001098000	chr14:95057086-95057233	148	IPSP_HUMAN	297-346	50	2	A:278-327 B:278-327	50 50
1.6	ENST00000329597	6	ENSE00001376792	chr14:95058394-95059457	1064	IPSP_HUMAN	347-406	60	2	A:328-387 B:328-387 (gaps)	60 60

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:360
 aligned with IPSP_HUMAN | P05154 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:360
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406
           IPSP_HUMAN    47 DFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP 406
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2ol2A01 A:28-189,A:285-338 Antithrombin, subunit I, domain 2                                                                                                      2ol2A02 A:190-284,A:344-387 Alpha-1-antitrypsin, domain 1                                      2ol2A01 A:28-189,A:285-338                            -----2ol2A02 A:190-284,A:344-387                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhh....eeehhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhh......eeeeeeeeeee.....hhhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhh................eeeeeeeeee..eee.......eeeeee.....eeeeeeeeeeeeeeeeee....eeeeeee.....eeeeeee...hhhhhhhhhhhhhhhhhhhhheeeeeeeeee.eeeeeeee.hhhhhhhh.hhhhh.................eeeeeeeeee...eee..................eeee....eeeeee...eeeeeee... Sec.struct. author
                 SAPs(SNPs) --------V--------N-----------------------------V----------E---------P-----A-----------------------------------------------------------------------------------------------R--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SERPIN     -------------- PROSITE
           Transcript 1 (1) Exon 1.3a  PDB: A:28-188 UniProt: 1-207 [INCOMPLETE]                                                                                                             -----------------------------------------------------------------------------------------Exon 1.5  PDB: A:278-327 UniProt: 297-346         Exon 1.6  PDB: A:328-387 UniProt: 347-406                    Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:188-278 UniProt: 207-297                                                  ------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2ol2 A  28 DFTFDLYRALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP 387
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387

Chain B from PDB  Type:PROTEIN  Length:343
 aligned with IPSP_HUMAN | P05154 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:361
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405 
           IPSP_HUMAN    46 RDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP 406
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2ol2B01 B:27-189,B:285-338 Antithrombin, subunit I, domain 2                                                                                                       2ol2B02 B:190-284,B:360-387 Alpha-1-antitrypsin, domain 1                                      2ol2B01 B:27-189,B:285-338                            ---------------------2ol2B02 B:190-284,B:360-387  CATH domains
           Pfam domains (1) Serpin-2ol2B01 B:27-387                                                                                                                                                                                                                                                                                                                                                   Pfam domains (1)
           Pfam domains (2) Serpin-2ol2B02 B:27-387                                                                                                                                                                                                                                                                                                                                                   Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhh....eeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh.....eeeeeeeeeeee.....hhhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhh................eeeeeeeeeee......hhhhheeeeee.....eeeeeeeeeeee.eeeee....eeeeeee.....eeeeeee...hhhhhhhh.hhhhhhhhhhhh...eeeeeee.eeeeeeee.hhhhhhhh.hhhhh.................eeeeeeeeee.....------------------...ee....eeeeee...eeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------V--------N-----------------------------V----------E---------P-----A-----------------------------------------------------------------------------------------------R--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SERPIN     -------------- PROSITE
           Transcript 1 (1) Exon 1.3a  PDB: B:27-188 UniProt: 1-207 [INCOMPLETE]                                                                                                              -----------------------------------------------------------------------------------------Exon 1.5  PDB: B:278-327 UniProt: 297-346         Exon 1.6  PDB: B:328-387 (gaps) UniProt: 347-406             Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: B:188-278 UniProt: 207-297                                                  ------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2ol2 B  27 RDFTFDLYRALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGT------------------SQRLVFNRPFLMFIVDNNILFLGKVNRP 387
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336    |    -         -   |   366       376       386 
                                                                                                                                                                                                                                                                                                                                                    341                360

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2OL2)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Antithrombin; Chain I, domain 2 (100)

Homologous Superfamily: Antithrombin, subunit I, domain 2 (100)

Human (Homo sapiens) (80)

1a	2ol2B01	B:27-189,B:285-338
1b	2ol2A01	A:28-189,A:285-338

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: Alpha-1-antitrypsin; domain 1 (101)

Homologous Superfamily: Alpha-1-antitrypsin, domain 1 (101)

Human (Homo sapiens) (81)

2a	2ol2B02	B:190-284,B:360-387
2b	2ol2A02	A:190-284,A:344-387

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Serpin] (63)

Family: Serpin (63)

Homo sapiens (Human) (41)

1a	Serpin-2ol2B01	B:27-387
1b	Serpin-2ol2B02	B:27-387

Asymmetric Unit(hide GO term definitions)

Chain A,B (IPSP_HUMAN | P05154)

molecular function
	GO:0032190	acrosin binding	Interacting selectively and non-covalently with acrosin, a protein that is found in the acrosomes of sperm and possesses protease and carbohydrate binding activities.
	GO:0005539	glycosaminoglycan binding	Interacting selectively and non-covalently with any glycan (polysaccharide) containing a substantial proportion of aminomonosaccharide residues.
	GO:0008201	heparin binding	Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0031210	phosphatidylcholine binding	Interacting selectively and non-covalently with phosphatidylcholine, a class of glycophospholipids in which a phosphatidyl group is esterified to the hydroxyl group of choline.
	GO:0002020	protease binding	Interacting selectively and non-covalently with any protease or peptidase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0001972	retinoic acid binding	Interacting selectively and non-covalently with retinoic acid, 3,7-dimethyl-9-(2,6,-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic acid.
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0007342	fusion of sperm to egg plasma membrane	The binding and fusion of a sperm, having penetrated the zona pellucida, with the plasma membrane of the oocyte. Binding occurs at the posterior (post-acrosomal) region of the sperm head.
	GO:0006869	lipid transport	The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0051346	negative regulation of hydrolase activity	Any process that stops or reduces the rate of hydrolase activity, the catalysis of the hydrolysis of various bonds.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
	GO:0045861	negative regulation of proteolysis	Any process that stops, prevents, or reduces the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
	GO:0007338	single fertilization	The union of male and female gametes to form a zygote.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0002080	acrosomal membrane	The membrane that surrounds the acrosomal lumen. The acrosome is a special type of lysosome in the head of a spermatozoon that contains acid hydrolases and is concerned with the breakdown of the outer membrane of the ovum during fertilization.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031091	platelet alpha granule	A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
	GO:0031094	platelet dense tubular network	A network of membrane-bounded compartments found in blood platelets, where they regulate platelet activation by sequestering or releasing calcium. The dense tubular network exists as thin elongated membranes in resting platelets, and undergoes a major ultrastructural change, to a rounded vesicular form, upon addition of thrombin.
	GO:0036029	protein C inhibitor-KLK3 complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and prostate-specific antigen (KLK3); formation of the complex inhibits the serine protease activity of prostate-specific antigen.
	GO:0036026	protein C inhibitor-PLAT complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and tissue-type plasminogen activator (PLAT); formation of the complex inhibits the serine protease activity of tissue-type plasminogen activator.
	GO:0036027	protein C inhibitor-PLAU complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and urokinase-type plasminogen activator (PLAU); formation of the complex inhibits the serine protease activity of urokinase-type plasminogen activator.
	GO:0036025	protein C inhibitor-TMPRSS11E complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and transmembrane protease serine 11E (TMPRSS11E); formation of the complex inhibits the serine protease activity of transmembrane protease serine 11E.
	GO:0036024	protein C inhibitor-TMPRSS7 complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and transmembrane protease serine 7 (TMPRSS7); formation of the complex inhibits the serine protease activity of transmembrane protease serine 7.
	GO:0097181	protein C inhibitor-coagulation factor V complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and coagulation factor V (F5); formation of the complex inhibits the serine protease activity of coagulation factor V.
	GO:0097183	protein C inhibitor-coagulation factor XI complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and coagulation factor XI (F11); formation of the complex inhibits the serine protease activity of coagulation factor XI.
	GO:0097182	protein C inhibitor-coagulation factor Xa complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and coagulation factor Xa (F10); formation of the complex inhibits the serine protease activity of coagulation factor Xa.
	GO:0036030	protein C inhibitor-plasma kallikrein complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and plasma kallikrein (KLK1B); formation of the complex inhibits the serine protease activity of plasma kallikrein.
	GO:0036028	protein C inhibitor-thrombin complex	A heterodimeric protein complex that contains protein C inhibitor (SERPINA5) and thrombin (F2); formation of the complex inhibits the serine protease activity of thrombin.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ol2)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ol2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IPSP_HUMAN \| P05154
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IPSP_HUMAN \| P05154
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IPSP_HUMAN \| P05154	:	1lq8 1pai 2hi9 2pai 3dy0

1lq8	CRYSTAL STRUCTURE OF CLEAVED PROTEIN C INHIBITOR
2hi9	CRYSTAL STRUCTURE OF HUMAN NATIVE PROTEIN C INHIBITOR (SPACE GROUP C2)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (7, 14)

PROSITE Motifs (1, 2)

Exons (4, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 4)

Pfam Domains (1, 2)

Gene Ontology (38, 38)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File