|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)
Asymmetric Unit (3, 4)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2OBP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2OBP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2OBP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2OBP) |
Exons (0, 0)| (no "Exon" information available for 2OBP) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:81 aligned with Q46TT3_CUPNJ | Q46TT3 from UniProtKB/TrEMBL Length:95 Alignment length:81 21 31 41 51 61 71 81 91 Q46TT3_CUPNJ 12 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP 92 SCOP domains d2obpa1 A:12-92 Putative DNA-binding protein ReutB4095 SCOP domains CATH domains 2obpA00 A:12-92 'winged helix' repressor DNA binding domain CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2obp A 12 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPmSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP 92 21 31 41 |51 61 71 81 91 49-MSE Chain B from PDB Type:PROTEIN Length:81 aligned with Q46TT3_CUPNJ | Q46TT3 from UniProtKB/TrEMBL Length:95 Alignment length:81 21 31 41 51 61 71 81 91 Q46TT3_CUPNJ 12 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP 92 SCOP domains d2obpb_ B: Putative DNA-binding protein ReutB4095 SCOP domains CATH domains 2obpB00 B:12-92 'winged helix' repressor DNA binding domain CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2obp B 12 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPmSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP 92 21 31 41 |51 61 71 81 91 49-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2OBP) |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q46TT3_CUPNJ | Q46TT3)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|