Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF PRO-SF-CASPASE-1
 
Authors :  A. J. Fisher, L. Ni
Date :  23 Oct 06  (Deposition) - 23 Oct 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  C,D
Keywords :  Pro-Sf-Caspase-1, Cysteine Protease, Procaspase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Ni, Z. Yu, D. Lemongello, P. D. Friesen, A. J. Fisher
Pro-Sfcapsase-1, Structural Insights Into Activation Mechanism Of Caspases
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CASPASE-1
    ChainsC, D
    EC Number3.4.22.36
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET22B(+)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    MutationYES
    Organism CommonFALL ARMYWORM
    Organism ScientificSPODOPTERA FRUGIPERDA
    Organism Taxid7108

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2NN3)

(-) Sites  (0, 0)

(no "Site" information available for 2NN3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2NN3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2NN3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2NN3)

(-) PROSITE Motifs  (4, 8)

Asymmetric/Biological Unit (4, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CASPASE_P20PS50208 Caspase family p20 domain profile.CASP1_SPOFR59-182
 
  2C:59-182
D:59-182
2CASPASE_HISPS01121 Caspase family histidine active site.CASP1_SPOFR123-137
 
  2C:123-137
D:123-137
3CASPASE_CYSPS01122 Caspase family cysteine active site.CASP1_SPOFR169-180
 
  2C:169-180
D:169-180
4CASPASE_P10PS50207 Caspase family p10 domain profile.CASP1_SPOFR200-295
 
  2C:201-293
D:200-295

(-) Exons   (0, 0)

(no "Exon" information available for 2NN3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain C from PDB  Type:PROTEIN  Length:235
 aligned with CASP1_SPOFR | P89116 from UniProtKB/Swiss-Prot  Length:299

    Alignment length:248
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285        
          CASP1_SPOFR    46 VDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRTETDGSPSTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVF 293
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2nn3C00 C:46-293  [code=3.40.50.1460, no name defined]                                                                                                                                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeeeee.............hhhhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhhh.hhhhh..eeeeeeeeee..eee....ee.hhhhhhhhh...hhhhh...eeeeeeee.........-------------.........eeeee.....eee....eeeehhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.................eeee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------CASPASE_P20  PDB: C:59-182 UniProt: 59-182                                                                                  -----------------CASPASE_P10  PDB: C:201-293 UniProt: 200-295                                                   PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ----------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nn3 C  46 VDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTAGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGI-------------SYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVF 293
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185 |       -     | 205       215       225       235       245       255       265       275       285        
                                                                                                                                                                       187           201                                                                                            

Chain D from PDB  Type:PROTEIN  Length:260
 aligned with CASP1_SPOFR | P89116 from UniProtKB/Swiss-Prot  Length:299

    Alignment length:260
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299
          CASP1_SPOFR    40 RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRTETDGSPSTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKKQSH 299
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2nn3D00 D:40-299  [code=3.40.50.1460, no name defined]                                                                                                                                                                                                               CATH domains
           Pfam domains (1) ---------------------Peptidase_C14-2nn3D01 D:61-293                                                                                                                                                                                                           ------ Pfam domains (1)
           Pfam domains (2) ---------------------Peptidase_C14-2nn3D02 D:61-293                                                                                                                                                                                                           ------ Pfam domains (2)
         Sec.struct. author ...................eeeeeeeee.............hhhhhhhhhhhhhhhh....eeee..hhhhhhhhhhhhhh.hhh.eeeeeeeeeeeee..eee....ee.hhhhhhhhhhhhh.......eeeeeeee...............................eeeee.....eee....eeeehhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.................eeee.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------CASPASE_P20  PDB: D:59-182 UniProt: 59-182                                                                                  -----------------CASPASE_P10  PDB: D:200-295 UniProt: 200-295                                                    ---- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ----------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nn3 D  40 RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTAGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRTETDGSPSTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKKQSH 299
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2NN3)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain C,D   (CASP1_SPOFR | P89116)
molecular function
    GO:0004197    cysteine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2nn3)
 
  Sites
(no "Sites" information available for 2nn3)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2nn3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2nn3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CASP1_SPOFR | P89116
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.22.36
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CASP1_SPOFR | P89116
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CASP1_SPOFR | P891161m72

(-) Related Entries Specified in the PDB File

1m72 CRYSTAL STRUCTURE OF CASPASE-1 FROM SPODOPTERA FRUGIPERDA