1M72 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF CASPASE-1 FROM SPODOPTERA FRUGIPERDA

Authors :   C. M. Forsyth, D. Lemongello, P. D. Friesen, A. J. Fisher

Date :   18 Jul 02 (Deposition) - 20 Jan 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B,D,E  (1x)
Biol. Unit 2: C,F  (2x)

Keywords :   Caspase, Cysteine Protease, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. M. Forsyth, D. Lemongello, D. J. Lacount, P. D. Friesen, A. J. Fisher
Crystal Structure Of An Invertebrate Caspase.
J. Biol. Chem. V. 279 7001 2004
PubMed-ID: 14645217 | Reference-DOI: 10.1074/JBC.M312472200

Molecule 1 - CASPASE-1
	Chains	:	A, B, C
	EC Number	:	3.4.22.36
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PET22B
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Organism Common	:	FALL ARMYWORM
	Organism Scientific	:	SPODOPTERA FRUGIPERDA
	Organism Taxid	:	7108

Molecule 2 - ACE-ASP-GLU-VAL-ASP-CHLOROMETHYLKETONE
	Chains	:	D, E, F
	Engineered	:	YES
	Other Details	:	THE PEPTIDE IS A SYNTHETIC TETRAPEPTIDE INHIBITOR.
	Synthetic	:	YES

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B		D	E
Biological Unit 2 (2x)	:			C			F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 14)

No.	Name	Count	Type	Full Name
1	0QE	3	Mod. Amino Acid	CHLOROMETHANE
2	ACE	3	Mod. Amino Acid	ACETYL GROUP
3	EDO	8	Ligand/Ion	1,2-ETHANEDIOL

Biological Unit 1 (3, 8)

No.	Name	Count	Type	Full Name
1	0QE	2	Mod. Amino Acid	CHLOROMETHANE
2	ACE	2	Mod. Amino Acid	ACETYL GROUP
3	EDO	4	Ligand/Ion	1,2-ETHANEDIOL

Biological Unit 2 (3, 12)

No.	Name	Count	Type	Full Name
1	0QE	2	Mod. Amino Acid	CHLOROMETHANE
2	ACE	2	Mod. Amino Acid	ACETYL GROUP
3	EDO	8	Ligand/Ion	1,2-ETHANEDIOL

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP A:184 , THR A:216 , VAL A:217 , TYR A:220 , GLN A:279 , VAL A:280 , HIS B:207	BINDING SITE FOR RESIDUE EDO A 506
02	AC2	SOFTWARE	PRO B:45 , VAL B:46 , TYR B:53 , ASN B:54 , HIS B:57 , ASP B:127 , GLY B:168 , LYS B:169 , PRO B:170	BINDING SITE FOR RESIDUE EDO B 503
03	AC3	SOFTWARE	HIS A:207 , ASP B:184 , THR B:216 , VAL B:217 , GLN B:279 , VAL B:280	BINDING SITE FOR RESIDUE EDO B 507
04	AC4	SOFTWARE	GLU C:138 , GLY C:140 , MET C:141 , LEU C:142 , PRO C:151 , CYS C:178 , GLN C:179 , PHE C:214	BINDING SITE FOR RESIDUE EDO C 501
05	AC5	SOFTWARE	ASP C:248 , ILE C:249 , LEU C:250 , THR C:254 , LEU C:287 , ARG C:289 , LEU C:290 , LEU C:291	BINDING SITE FOR RESIDUE EDO C 502
06	AC6	SOFTWARE	ASP C:184 , HIS C:207 , THR C:216 , VAL C:217 , GLN C:279 , VAL C:280	BINDING SITE FOR RESIDUE EDO C 504
07	AC7	SOFTWARE	LEU C:183 , ASP C:184 , GLY C:185 , GLY C:186	BINDING SITE FOR RESIDUE EDO C 508
08	AC8	SOFTWARE	LYS A:77 , ARG A:79 , THR A:135 , HIS A:136 , GLY A:137 , GLN A:176 , CYS A:178 , PHE A:221 , SER A:222 , TRP A:223 , ARG A:224 , ASN A:225 , THR A:226 , SER A:266 , ASN A:267 , MET A:274 , HIS B:74 , HOH D:1050	BINDING SITE FOR CHAIN D OF ACE-ASP-GLU-VAL-ASP- CHLOROMETHYLKETONE
09	AC9	SOFTWARE	HIS A:74 , ARG B:79 , THR B:135 , HIS B:136 , GLY B:137 , GLN B:176 , CYS B:178 , PHE B:221 , SER B:222 , TRP B:223 , ARG B:224 , ASN B:225 , THR B:226 , SER B:266 , ASN B:267 , MET B:274 , HOH E:1013 , HOH E:1173	BINDING SITE FOR CHAIN E OF ACE-ASP-GLU-VAL-ASP- CHLOROMETHYLKETONE
10	BC1	SOFTWARE	HIS C:74 , ARG C:79 , THR C:135 , HIS C:136 , GLY C:137 , GLN C:176 , CYS C:178 , PHE C:221 , SER C:222 , TRP C:223 , ARG C:224 , ASN C:225 , THR C:226 , SER C:266 , ASN C:267 , HOH F:1088 , HOH F:1091	BINDING SITE FOR CHAIN F OF ACE-ASP-GLU-VAL-ASP- CHLOROMETHYLKETONE

(no "SS Bond" information available for 1M72)

(no "Cis Peptide Bond" information available for 1M72)

(no "SAP(SNP)/Variant" information available for 1M72)

Asymmetric Unit (4, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP1_SPOFR	59-182	3	A:59-182 B:59-182 C:59-182
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP1_SPOFR	123-137	3	A:123-137 B:123-137 C:123-137
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP1_SPOFR	169-180	3	A:169-180 B:169-180 C:169-180
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP1_SPOFR	200-295	3	A:201-295 B:200-295 C:201-295

Biological Unit 1 (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP1_SPOFR	59-182	2	A:59-182 B:59-182 -
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP1_SPOFR	123-137	2	A:123-137 B:123-137 -
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP1_SPOFR	169-180	2	A:169-180 B:169-180 -
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP1_SPOFR	200-295	2	A:201-295 B:200-295 -

Biological Unit 2 (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP1_SPOFR	59-182	2	- - C:59-182
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP1_SPOFR	123-137	2	- - C:123-137
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP1_SPOFR	169-180	2	- - C:169-180
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP1_SPOFR	200-295	2	- - C:201-295

(no "Exon" information available for 1M72)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:247
 aligned with CASP1_SPOFR | P89116 from UniProtKB/Swiss-Prot  Length:299

    Alignment length:256
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289      
          CASP1_SPOFR    40 RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRTETDGSPSTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGK 295
               SCOP domains d1m72a_ A: Caspase-1                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1m72A00 A:40-295  [code=3.40.50.1460, no name defined]                                                                                                                                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................eeeeeeeee.............hhhhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhhh.....eeeeeeeee..ee..eee....ee..hhhhhh.....hhhhh...eeeeee..........eeee.---------.eee.....eeeee........eee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhh......eeee.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------CASPASE_P20  PDB: A:59-182 UniProt: 59-182                                                                                  -----------------CASPASE_P10  PDB: A:201-295 UniProt: 200-295                                                     PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m72 A  40 RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSR---------SYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGK 295
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189 |       - |     209       219       229       239       249       259       269       279       289      
                                                                                                                                                                                 191       201

Chain B from PDB  Type:PROTEIN  Length:248
 aligned with CASP1_SPOFR | P89116 from UniProtKB/Swiss-Prot  Length:299

    Alignment length:256
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290      
          CASP1_SPOFR    41 VARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRTETDGSPSTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKK 296
               SCOP domains d1m72b_ B: Caspase-1                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1m72B00 B:41-296  [code=3.40.50.1460, no name defined]                                                                                                                                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee...............eeeeeeeee.............hhhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhh....eeeeeeeee..ee..eee....ee..hhhhhh.....hhhhh...eeeeee..........eeee.--------.eeee.....eeeee........eee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhh......eeee........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------CASPASE_P20  PDB: B:59-182 UniProt: 59-182                                                                                  -----------------CASPASE_P10  PDB: B:200-295 UniProt: 200-295                                                    - PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS -------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m72 B  41 VARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSR--------TSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKK 296
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190|      200       210       220       230       240       250       260       270       280       290      
                                                                                                                                                                                191      200

Chain C from PDB  Type:PROTEIN  Length:252
 aligned with CASP1_SPOFR | P89116 from UniProtKB/Swiss-Prot  Length:299

    Alignment length:261
                                                                                                                                                                                                                                                                                             299 
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299 
          CASP1_SPOFR    40 RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRTETDGSPSTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKKQSH-   -
               SCOP domains d1m72c_ C: Caspase-1                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 1m72C00 C:40-300  [code=3.40.50.1460, no name defined]                                                                                                                                                                                                                CATH domains
           Pfam domains (1) ---------------------Peptidase_C14-1m72C01 C:61-293                                                                                                                                                                                                           ------- Pfam domains (1)
           Pfam domains (2) ---------------------Peptidase_C14-1m72C02 C:61-293                                                                                                                                                                                                           ------- Pfam domains (2)
           Pfam domains (3) ---------------------Peptidase_C14-1m72C03 C:61-293                                                                                                                                                                                                           ------- Pfam domains (3)
         Sec.struct. author ......................eeeeee.............hhhhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhhhh.......eeeeee..ee..eee....ee.hhhhhhh.....hhhhh...eeeeee...............---------.........eeeee........eee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhh......eeee............... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------CASPASE_P20  PDB: C:59-182 UniProt: 59-182                                                                                  -----------------CASPASE_P10  PDB: C:201-295 UniProt: 200-295                                                    ----- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m72 C  40 RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSR---------SYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKKQSHL 300
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189 |       - |     209       219       229       239       249       259       269       279       289       299 
                                                                                                                                                                                 191       201

Chain D from PDB  Type:PROTEIN  Length:6
                                      
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ..ee.. Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 1m72 D 500 xDEVDx 505
                            |    |
                          500-ACE|
                               505-0QE

Chain E from PDB  Type:PROTEIN  Length:6
                                      
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ..ee.. Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 1m72 E 500 xDEVDx 505
                            |    |
                            |    |
                          500-ACE|
                               505-0QE

Chain F from PDB  Type:PROTEIN  Length:6
                                      
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ..ee.. Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 1m72 F 500 xDEVDx 505
                            |    |
                            |    |
                          500-ACE|
                               505-0QE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Caspase-like (92)

Superfamily: Caspase-like (92)

Family: Caspase catalytic domain (76)

Protein domain: Caspase-1 (1)

Fall armyworm (Spodoptera frugiperda) [TaxId: 7108] (1)

1a	d1m72a_	A:
1b	d1m72b_	B:
1c	d1m72c_	C:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.1460, no name defined] (93)

Fall armyworm (Spodoptera frugiperda) (2)

1a	1m72A00	A:40-295
1b	1m72B00	B:41-296
1c	1m72C00	C:40-300

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Peptidase_CD (53)

Family: Peptidase_C14 (53)

Spodoptera frugiperda (Fall armyworm) (2)

1a	Peptidase_C14-1m72C01	C:61-293
1b	Peptidase_C14-1m72C02	C:61-293
1c	Peptidase_C14-1m72C03	C:61-293

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (CASP1_SPOFR | P89116)

molecular function
	GO:0004197	cysteine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0008234	cysteine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		0QE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ACE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1m72)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1m72
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CASP1_SPOFR \| P89116
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.22.36
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CASP1_SPOFR \| P89116
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CASP1_SPOFR \| P89116	:	2nn3

(no "Related Entries Specified in the PDB File" available for 1M72)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 14)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 12)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (1, 3)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File