Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF TAMA POTRA DOMAIN I
 
Authors :  S. Headey, M. Belousoff, T. Lithgow
Date :  11 Sep 12  (Deposition) - 12 Mar 14  (Release) - 12 Mar 14  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  1  (10x)
NMR Structure *:  1  (1x)
Keywords :  Tama, Potra, Tam, Autotransporter Secretion, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Selkrig, S. Headey, M. Belousoff, N. Celik, M. Phan, M. Schembri, M. Scanlon, T. Lithgow
The C-Terminal Beta-Signal-Like Motif Of Tamb Facilitates Efficient Autotransporter Secretion.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - TRANSLOCATION AND ASSEMBLY MODULE TAMA
    Chains1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-21D
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL BETA-SIGNAL-LIKE MOTIF
    GeneTAMA, YFTM, YTFM, B4220, JW4179
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83333
    StrainK12
    SynonymAUTOTRANSPORTER ASSEMBLY FACTOR TAMA

 Structural Features

(-) Chains, Units

  1
NMR Structure (10x)1
NMR Structure * (1x)1

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LY3)

(-) Sites  (0, 0)

(no "Site" information available for 2LY3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LY3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LY3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LY3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LY3)

(-) Exons   (0, 0)

(no "Exon" information available for 2LY3)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 1 from PDB  Type:PROTEIN  Length:89
 aligned with TAMA_ECOLI | P0ADE4 from UniProtKB/Swiss-Prot  Length:577

    Alignment length:123
                                    31        41        51        61        71        81        91       101       111       121       131       141   
           TAMA_ECOLI    22 ANVRLQVEGLSGQLEKNVRAQLSTIESDEVTPDRRFRARVDDAIREGLKALGYYQPTIEFDLRPPPKKGRQVLIAKVTPGVPVLIGGTDVVLRGGARTDKDYLKLLDTRPAIGTVLNQGDYEN 144
               SCOP domains --------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh......eeeeeee........eeeeeee..----------------------------------......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ly3 1  22 ANVRLQVEGLSGQLEKNVRAQLSTIESDEVTPDRRFRARVDDAIREGLKALGYYQPTIEFDLRPPPKKGRQVLIAKVTPG----------------------------------VLEHHHHHH 110
                                    31        41        51        61        71        81        91       101         -         -         -    |  107   
                                                                                                         101                                102        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LY3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LY3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LY3)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain 1   (TAMA_ECOLI | P0ADE4)
biological process
    GO:0009306    protein secretion    The controlled release of proteins from a cell.
cellular component
    GO:0097347    TAM protein secretion complex    A heterooligomeric protein complex that spans the bacterial periplasm and enables the secretion of adhesin proteins in Gram-negative bacteria. In Citrobacter rodentium, Salmonella enterica and Escherichia coli, the TAM complex consists of an Omp85-family protein, TamA, in the outer membrane and TamB in the inner membrane.
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
    GO:0045203    integral component of cell outer membrane    The component of the cell outer membrane consisting of the gene products having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019867    outer membrane    The external membrane of Gram-negative bacteria or certain organelles such as mitochondria and chloroplasts; freely permeable to most ions and metabolites.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ly3)
 
  Sites
(no "Sites" information available for 2ly3)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ly3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ly3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TAMA_ECOLI | P0ADE4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TAMA_ECOLI | P0ADE4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TAMA_ECOLI | P0ADE44bza 4c00

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LY3)