Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE THIRD SH3 DOMAIN OF R85FL
 
Authors :  Y. Jiang, H. Hu
Date :  02 Sep 11  (Deposition) - 05 Sep 12  (Release) - 05 Sep 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
NMR Structure *:  A  (1x)
Keywords :  Sh3, R85Fl, Ponsin, Cap, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Jiang, C. Zhou, Z. Zhou, H. Hu
Structure Basis For The Recognition Of Ataxin-7 Prr With R85Fl Sh3 Domain
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SORBIN AND SH3 DOMAIN-CONTAINING PROTEIN 1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PET-22B
    Expression System Vector Type: VECTOR
    Fragment: THIRD SH3 DOMAIN
    Gene: SORBS1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: PONSIN, SH3 DOMAIN PROTEIN 5, SH3P12, C-CBL-ASSOCIATED PROTEIN, CAP

 Structural Features

(-) Chains, Units

  1
NMR Structure (15x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LJ0)

(-) Sites  (0, 0)

(no "Site" information available for 2LJ0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LJ0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LJ0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LJ0)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH3PS50002 Src homology 3 (SH3) domain profile.SRBS1_HUMAN793-852
867-928
1231-1292
  1-
-
A:4-65
NMR Structure * (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH3PS50002 Src homology 3 (SH3) domain profile.SRBS1_HUMAN793-852
867-928
1231-1292
  1-
-
A:4-65

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003712471bENSE00001402421chr10:97321135-9732107759SRBS1_HUMAN-00--
1.3aENST000003712473aENSE00001802906chr10:97250877-9725079286SRBS1_HUMAN-00--
1.5aENST000003712475aENSE00002181580chr10:97200937-9720088355SRBS1_HUMAN1-440--
1.6ENST000003712476ENSE00001198082chr10:97197312-9719724766SRBS1_HUMAN4-26230--
1.7ENST000003712477ENSE00000810934chr10:97194474-9719437996SRBS1_HUMAN26-58330--
1.8ENST000003712478ENSE00001122732chr10:97192333-97192205129SRBS1_HUMAN58-101440--
1.9ENST000003712479ENSE00001122727chr10:97181973-9718194727SRBS1_HUMAN101-110100--
1.10aENST0000037124710aENSE00001122718chr10:97181830-97181718113SRBS1_HUMAN110-147380--
1.13bENST0000037124713bENSE00001352339chr10:97174619-97174251369SRBS1_HUMAN148-2701230--
1.15ENST0000037124715ENSE00000810940chr10:97170534-97170390145SRBS1_HUMAN271-319490--
1.16ENST0000037124716ENSE00001021690chr10:97165904-9716587530SRBS1_HUMAN319-329110--
1.17ENST0000037124717ENSE00001021693chr10:97158946-97158774173SRBS1_HUMAN329-386580--
1.18ENST0000037124718ENSE00000810948chr10:97157040-9715697764SRBS1_HUMAN387-408220--
1.19ENST0000037124719ENSE00000716757chr10:97154832-9715475875SRBS1_HUMAN408-433260--
1.20ENST0000037124720ENSE00000987298chr10:97154430-9715436863SRBS1_HUMAN433-454220--
1.23ENST0000037124723ENSE00000810949chr10:97144042-9714399548SRBS1_HUMAN454-470170--
1.24bENST0000037124724bENSE00000810954chr10:97143871-97143742130SRBS1_HUMAN470-513440--
1.25bENST0000037124725bENSE00000987285chr10:97141556-97141442115SRBS1_HUMAN513-551390--
1.26ENST0000037124726ENSE00000987299chr10:97135813-9713573084SRBS1_HUMAN552-579280--
1.27ENST0000037124727ENSE00000987300chr10:97131806-9713174166SRBS1_HUMAN580-601220--
1.28ENST0000037124728ENSE00000987301chr10:97131184-97131083102SRBS1_HUMAN602-635340--
1.29ENST0000037124729ENSE00000987286chr10:97127456-9712740750SRBS1_HUMAN636-652170--
1.30ENST0000037124730ENSE00000987287chr10:97117560-97117388173SRBS1_HUMAN652-710590--
1.31ENST0000037124731ENSE00001214532chr10:97114724-9711463986SRBS1_HUMAN710-738290--
1.32ENST0000037124732ENSE00000987296chr10:97111133-97110966168SRBS1_HUMAN739-794560--
1.33ENST0000037124733ENSE00000987289chr10:97106209-9710616347SRBS1_HUMAN795-810160--
1.34ENST0000037124734ENSE00000987290chr10:97101435-97101321115SRBS1_HUMAN810-848390--
1.35ENST0000037124735ENSE00000987291chr10:97101167-97101042126SRBS1_HUMAN849-890420--
1.36aENST0000037124736aENSE00000987292chr10:97099084-97098890195SRBS1_HUMAN891-955650--
1.37aENST0000037124737aENSE00001214682chr10:97097051-97096278774SRBS1_HUMAN956-12132580--
1.39ENST0000037124739ENSE00000987293chr10:97081778-9708172059SRBS1_HUMAN1214-1233201A:1-66
1.40ENST0000037124740ENSE00000987294chr10:97078189-97078077113SRBS1_HUMAN1233-1271391A:6-4439
1.41cENST0000037124741cENSE00001383385chr10:97074883-970715313353SRBS1_HUMAN1271-1292221A:44-6522

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:65
 aligned with SRBS1_HUMAN | Q9BX66 from UniProtKB/Swiss-Prot  Length:1292

    Alignment length:65
                                  1237      1247      1257      1267      1277      1287     
         SRBS1_HUMAN   1228 QTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL 1292
               SCOP domains d2lj0a_ A: automated matches                                      SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee..................eeeeeee....eeeeee.....eeeee...eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---SH3  PDB: A:4-65 UniProt: 1231-1292                            PROSITE
           Transcript 1 (1) 1.39  -------------------------------------Exon 1.41c             Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.40  PDB: A:6-44                 --------------------- Transcript 1 (2)
                2lj0 A    1 QTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL   65
                                    10        20        30        40        50        60     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LJ0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LJ0)

(-) Gene Ontology  (37, 37)

NMR Structure(hide GO term definitions)
Chain A   (SRBS1_HUMAN | Q9BX66)
molecular function
    GO:0005070    SH3/SH2 adaptor activity    Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0008092    cytoskeletal protein binding    Interacting selectively and non-covalently with any protein component of any cytoskeleton (actin, microtubule, or intermediate filament cytoskeleton).
    GO:0005158    insulin receptor binding    Interacting selectively and non-covalently with the insulin receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007015    actin filament organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0032869    cellular response to insulin stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0048041    focal adhesion assembly    The aggregation and bonding together of a set of components to form a focal adhesion, a complex of intracellular signaling and structural proteins that provides a structural link between the internal actin cytoskeleton and the ECM, and also function as a locus of signal transduction activity.
    GO:0015758    glucose transport    The directed movement of the hexose monosaccharide glucose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0008286    insulin receptor signaling pathway    The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
    GO:0006936    muscle contraction    A process in which force is generated within muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis.
    GO:0090004    positive regulation of establishment of protein localization to plasma membrane    Any process that increases the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.
    GO:0046326    positive regulation of glucose import    Any process that activates or increases the frequency, rate or extent of the import of the hexose monosaccharide glucose into a cell or organelle.
    GO:0045725    positive regulation of glycogen biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of glycogen.
    GO:0046889    positive regulation of lipid biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of lipids.
    GO:0009967    positive regulation of signal transduction    Any process that activates or increases the frequency, rate or extent of signal transduction.
    GO:0043149    stress fiber assembly    The aggregation, arrangement and bonding together of a set of components to form a stress fiber. A stress fiber is a contractile actin filament bundle that consists of short actin filaments with alternating polarity.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005912    adherens junction    A cell junction at which anchoring proteins (cadherins or integrins) extend through the plasma membrane and are attached to actin filaments.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0005913    cell-cell adherens junction    An adherens junction which connects a cell to another cell.
    GO:0005924    cell-substrate adherens junction    An adherens junction which connects a cell to the extracellular matrix.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0005899    insulin receptor complex    A disulfide-bonded, heterotetrameric receptor complex. The alpha chains are entirely extracellular, while each beta chain has one transmembrane domain. The ligand binds to the alpha subunit extracellular domain and the kinase is associated with the beta subunit intracellular domain.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045121    membrane raft    Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
    GO:0016363    nuclear matrix    The dense fibrillar network lying on the inner side of the nuclear membrane.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0001725    stress fiber    A contractile actin filament bundle that consists of short actin filaments with alternating polarity, cross-linked by alpha-actinin and possibly other actin bundling proteins, and with myosin present in a periodic distribution along the fiber.
    GO:0005915    zonula adherens    A cell-cell adherens junction which forms a continuous belt near the apex of epithelial cells.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lj0)
 
  Sites
(no "Sites" information available for 2lj0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lj0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lj0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SRBS1_HUMAN | Q9BX66
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SRBS1_HUMAN | Q9BX66
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SRBS1_HUMAN | Q9BX66: 2dl3 2ecz 2lj1 2mox 2o2w 2o31 2o9s 2o9v 4ln2 4lnp

(-) Related Entries Specified in the PDB File

2lj1