|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2LFP) |
Sites (0, 0)| (no "Site" information available for 2LFP) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2LFP) |
Cis Peptide Bonds (1, 20)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2LFP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2LFP) |
Exons (0, 0)| (no "Exon" information available for 2LFP) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:139 aligned with COMPL_BPSPP | O48448 from UniProtKB/Swiss-Prot Length:134 Alignment length:139 1 134 | 7 17 27 37 47 57 67 77 87 97 107 117 127 | COMPL_BPSPP - ---MTWKLASRALQKATVENLESYQPLMEMVNQVTESPGKDDPYPYVVIGDQSSTPFETKSSFGENITMDFHVWGGTTRAEAQDISSRVLEALTYKPLMFEGFTFVAKKLVLAQVITDTDGVTKHGIIKVRFTINNN-- - SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2lfp A -4 QGLQTWKLASRALQKATVENLESYQPLMEMVNQVTESPGKDDPYPYVVIGDQSSTPFETKSSFGENITMDFHVWGGTTRAEAQDISSRVLEALTYKPLMFEGFTFVAKKLVLAQVITDTDGVTKHGIIKVRFTINNNTG 201 || 7 17 27 37 47 57 67 77 87 97 107 117 127 || -1| 134| 2 200
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2LFP) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2LFP) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2LFP) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2LFP)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|