|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2L76) |
Sites (0, 0)| (no "Site" information available for 2L76) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2L76) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2L76) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2L76) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2L76) |
Exons (3, 3)
NMR Structure (3, 3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:95 aligned with NF2IP_HUMAN | Q8NCF5 from UniProtKB/Swiss-Prot Length:419 Alignment length:95 253 263 273 283 293 303 313 323 333 NF2IP_HUMAN 244 QGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSS 338 SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.5 PDB: A:244-282 [INCOMPLETE] Exon 1.6 PDB: A:283-331 UniProt: 283-331 ------- Transcript 1 (1) Transcript 1 (2) ---------------------------------------------------------------------------------------Exon 1.7 Transcript 1 (2) 2l76 A 244 QGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSS 338 253 263 273 283 293 303 313 323 333
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2L76) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2L76) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2L76) |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (NF2IP_HUMAN | Q8NCF5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|