Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF UBIQUITIN-LIKE DOMAIN OF NFATC2IP. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR5627
 
Authors :  R. S. Doherty, S. Dhe-Paganon, C. Fares, A. Lemak, C. Butler, S. Srisailam, M. Karra, A. Yee, A. M. Edwards, J. Weigelt, C. H. Arrowsmith, Northeast Structural Genomics Consortium (Nesg), Structural Genomics Consortium (Sgc)
Date :  30 Nov 07  (Deposition) - 11 Dec 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Nuclear Factor Of Activated T-Cells, Cytoplasmic 2- Interacting Protein, Ubiquitin Like Homologue, Nfat Complex, Alternative Splicing, Coiled Coil, Methylation, Nucleus, Phosphoprotein, Polymorphism, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Structural Genomics Consortium, Sgc, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. S. Doherty, S. Dhe-Paganon, C. Fares, A. Lemak, C. Butler, S. Srisailam, M. Karra, A. Yee, J. Weigelt, A. M. Edwards, C. H. Arrowsmith
Solution Structure Of Ubiquitin-Like Domain Of Nfatc2Ip.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NFATC2-INTERACTING PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET28-MHL
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentUBIQUITIN-LIKE DOMAIN: RESIDUES 342-419
    GeneNFATC2IP, NIP45
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNUCLEAR FACTOR OF ACTIVATED T-CELLS, CYTOPLASMIC 2-INTERACTING PROTEIN, 45 KDA NFAT-INTERACTING PROTEIN, 45 KDA NF-AT-INTERACTING PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JXX)

(-) Sites  (0, 0)

(no "Site" information available for 2JXX)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JXX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JXX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JXX)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.NF2IP_HUMAN348-417  1A:26-95

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003208051bENSE00001222380chr16:28962315-28962719405NF2IP_HUMAN1-1291290--
1.2ENST000003208052ENSE00001596297chr16:28963453-2896352573NF2IP_HUMAN130-154250--
1.3ENST000003208053ENSE00001730472chr16:28965886-28966003118NF2IP_HUMAN154-193400--
1.4ENST000003208054ENSE00001686663chr16:28967299-2896737981NF2IP_HUMAN193-220280--
1.5ENST000003208055ENSE00001799531chr16:28967472-28967658187NF2IP_HUMAN220-282630--
1.6ENST000003208056ENSE00001698347chr16:28970038-28970182145NF2IP_HUMAN283-331490--
1.7ENST000003208057ENSE00001222324chr16:28970312-28970421110NF2IP_HUMAN331-367371A:20-4526
1.8bENST000003208058bENSE00001222368chr16:28975026-289784183393NF2IP_HUMAN368-419521A:46-9752

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:78
 aligned with NF2IP_HUMAN | Q8NCF5 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:78
                                   351       361       371       381       391       401       411        
          NF2IP_HUMAN   342 TETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG 419
               SCOP domains d2jxxa_ A: automated matches                                                   SCOP domains
               CATH domains 2jxxA00 A:20-97                                                                CATH domains
               Pfam domains ------Rad60-SLD-2jxxA01 A:26-96                                              - Pfam domains
         Sec.struct. author .....eeeeeeee.....eeeeeee...hhhhhhhhhhhhh.......eeee..ee.....hhhhhh....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------UBIQUITIN_2  PDB: A:26-95 UniProt: 348-417                            -- PROSITE
               Transcript 1 Exon 1.7  PDB: A:20-45    Exon 1.8b  PDB: A:46-97 UniProt: 368-419             Transcript 1
                 2jxx A  20 TETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG  97
                                    29        39        49        59        69        79        89        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Ubiquitin (279)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (NF2IP_HUMAN | Q8NCF5)
molecular function
    GO:0031386    protein tag    A molecular function exhibited by a protein that is covalently attached (AKA tagged or conjugated) to another protein where it acts as a marker, recognized by the cellular apparatus to target the tagged protein for some cellular process such as modification, sequestration, transport or degradation.
biological process
    GO:0001816    cytokine production    The appearance of a cytokine due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jxx)
 
  Sites
(no "Sites" information available for 2jxx)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jxx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jxx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NF2IP_HUMAN | Q8NCF5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NF2IP_HUMAN | Q8NCF5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NF2IP_HUMAN | Q8NCF52l76 3rd2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JXX)