Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF CYCLOVIOLACIN O2
 
Authors :  C. K. Wang
Date :  22 Dec 08  (Deposition) - 21 Jul 09  (Release) - 15 Sep 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Cyclic Cystine Knot, Cytolysis, Hemolysis, Knottin, Plant Defense, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. K. Wang, M. L. Colgrave, D. C. Ireland, Q. Kaas, D. J. Craik
Despite A Conserved Cystine Knot Motif, Different Cyclotides Have Different Membrane Binding Modes.
Biophys. J. V. 97 1471 2009
PubMed-ID: 19720036  |  Reference-DOI: 10.1016/J.BPJ.2009.06.032
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYCLOVIOLACIN-O2
    Chains: A
    Organism Common: SWEET VIOLET
    Organism Scientific: VIOLA ODORATA
    Organism Taxid: 97441

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KCG)

(-) Sites  (0, 0)

(no "Site" information available for 2KCG)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:4 -A:20
2A:8 -A:22
3A:13 -A:27

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KCG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KCG)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYCLOTIDEPS51052 Cyclotides profile.CYO2_VIOOD1-30  1A:1-30
2CYCLOTIDE_BRACELETPS60008 Cyclotides bracelet subfamily signature.CYO2_VIOOD4-13  1A:4-13

(-) Exons   (0, 0)

(no "Exon" information available for 2KCG)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:30
 aligned with CYO2_VIOOD | P58434 from UniProtKB/Swiss-Prot  Length:30

    Alignment length:30
                                    10        20        30
            CYO2_VIOOD    1 GIPCGESCVWIPCISSAIGCSCKSKVCYRN 30
               SCOP domains d2kcga_ A: automated matches   SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains Cyclotide-2kcgA01 A:1-30       Pfam domains
         Sec.struct. author .ee.........hhhhhhh.eee..eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                PROSITE (1) CYCLOTIDE  PDB: A:1-30         PROSITE (1)
                PROSITE (2) ---CYCLOTIDE_----------------- PROSITE (2)
                 Transcript ------------------------------ Transcript
                  2kcg A  1 GIPCGESCVWIPCISSAIGCSCKSKVCYRN 30
                                    10        20        30
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KCG)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Cyclotide] (21)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (CYO2_VIOOD | P58434)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0019835    cytolysis    The rupture of cell membranes and the loss of cytoplasm.
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0044179    hemolysis in other organism    The cytolytic destruction of red blood cells, with the release of intracellular hemoglobin, in one organism by another.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kcg)
 
  Sites
(no "Sites" information available for 2kcg)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kcg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kcg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYO2_VIOOD | P58434
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CYO2_VIOOD | P58434
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYO2_VIOOD | P58434: 2knm 2knn

(-) Related Entries Specified in the PDB File

2kch