|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2K1P) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2K1P) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2K1P) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:33 aligned with ZRAB2_HUMAN | O95218 from UniProtKB/Swiss-Prot Length:330 Alignment length:47 58 68 78 88 ZRAB2_HUMAN 49 GTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAK 95 SCOP domains ----------------------------------------------- SCOP domains CATH domains ----------------------------------------------- CATH domains Pfam domains ----------------zf-RanBP-2k1pA01 A:65-94 - Pfam domains SAPs(SNPs) ----------------------------------------------- SAPs(SNPs) PROSITE (1) ----------------ZF_RANBP2_2 PDB: A:65-94 - PROSITE (1) PROSITE (2) --------------------ZF_RANBP2_1 ------- PROSITE (2) Transcript 1 (1) Exon 1.3 UniProt: 37-73 ---------------------- Transcript 1 (1) Transcript 1 (2) ------------------------Exon 1.4 PDB: A:73-95 Transcript 1 (2) 2k1p A 63 GS--------------SANDWQCKTCSNVNWARRSECNMCNTPKYAK 95 | - | 68 78 88 | 65 64
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2K1P) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2K1P) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (10, 10)|
NMR Structure(hide GO term definitions) Chain A (ZRAB2_HUMAN | O95218)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|