|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2JS1) |
(no "Site" information available for 2JS1) |
(no "SS Bond" information available for 2JS1) |
(no "Cis Peptide Bond" information available for 2JS1) |
(no "SAP(SNP)/Variant" information available for 2JS1) |
(no "PROSITE Motif" information available for 2JS1) |
(no "Exon" information available for 2JS1) |
NMR StructureChain A from PDB Type:PROTEIN Length:80 aligned with YVFG_BACSU | P71066 from UniProtKB/Swiss-Prot Length:72 Alignment length:80 72 10 20 30 40 50 60 70 | - YVFG_BACSU 1 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESK-------- - SCOP domains d2js1a_ A: Hypothetical protein YvfG SCOP domains CATH domains -------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------- Transcript 2js1 A 1 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH 80 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:80 aligned with YVFG_BACSU | P71066 from UniProtKB/Swiss-Prot Length:72 Alignment length:80 72 10 20 30 40 50 60 70 | - YVFG_BACSU 1 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESK-------- - SCOP domains d2js1b_ B: Hypothetical protein YvfG SCOP domains CATH domains -------------------------------------------------------------------------------- CATH domains Pfam domains (1) --YvfG-2js1B01 B:3-69 ----------- Pfam domains (1) Pfam domains (2) --YvfG-2js1B02 B:3-69 ----------- Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------- Transcript 2js1 B 1 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH 80 10 20 30 40 50 60 70 80
|
NMR Structure |
(no "CATH Domain" information available for 2JS1) |
NMR Structure
|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2JS1)
|
|
|
|
|
|
|