|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 6) Biological Unit 1 (2, 6) Biological Unit 2 (2, 12) Biological Unit 3 (2, 6) |
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 2GSV) |
(no "Cis Peptide Bond" information available for 2GSV) |
(no "SAP(SNP)/Variant" information available for 2GSV) |
(no "PROSITE Motif" information available for 2GSV) |
(no "Exon" information available for 2GSV) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:67 aligned with YVFG_BACSU | P71066 from UniProtKB/Swiss-Prot Length:72 Alignment length:67 12 22 32 42 52 62 YVFG_BACSU 3 ELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRG 69 SCOP domains d2gsva1 A:3-69 Hypothetical protein YvfG SCOP domains CATH domains ------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 2gsv A 3 ELFSVPYFIENLKQHIEmNQSEDKIHAmNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRG 69 12 |22 |32 42 52 62 20-MSE 30-MSE Chain B from PDB Type:PROTEIN Length:68 aligned with YVFG_BACSU | P71066 from UniProtKB/Swiss-Prot Length:72 Alignment length:68 11 21 31 41 51 61 YVFG_BACSU 2 SELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRG 69 SCOP domains d2gsvb_ B: Hypothetical protein YvfG SCOP domains CATH domains -------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 2gsv B 2 SELFSVPYFIENLKQHIEmNQSEDKIHAmNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRG 69 11 21 31 41 51 61 20-MSE 30-MSE
|
Asymmetric Unit |
(no "CATH Domain" information available for 2GSV) |
(no "Pfam Domain" information available for 2GSV) |
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2GSV)
|
|
|
|
|
|
|