2JI4 - JenaLib

Title :   HUMAN PHOSPHORIBOSYLPYROPHOSPHATE SYNTHETASE - ASSOCIATED PROTEIN 41 (PAP41)

Authors :   M. Moche, L. Lehtio, C. Arrowsmith, H. Berglund, R. Busam, R. Collins, L. G. Dahlgren, A. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, B. M. Hallberg, L. Holmberg-Schiavone, I. Johansson, T. Karlberg, T. Kotenyova, T. Nyman, D. Ogg, C. Persson, J. Sagemark, P. Stenmark, M. Sundstrom, A. G. Thorsell, S. Van Den Berg, J. Weigelt, P. Nordlund

Date :   26 Feb 07 (Deposition) - 06 Mar 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.55

Chains :   Asym. Unit : A
Biol. Unit 1: A  (6x)

Keywords :   Phosphorylation, Nucleotide Biosynthesis, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Moche, L. Lehtio, C. Arrowsmith, H. Berglund, R. Busam, R. Collins, L. G. Dahlgren, A. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, B. M. Hallberg, L. Holmberg-Schiavone, I. Johansson, T. Karlberg, T. Kotenyova, T. Nyman, D. Ogg, C. Persson, J. Sagemark, P. Stenmark, M. Sundstrom, A. G. Thorsell, S. Van Den Berg, J. Weigelt, P. Nordlund
Human Phosphoribosylpyrophosphate Synthetase - Associated Protein 41 (Pap41)
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (10, 10)

Asymmetric Unit (10, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.5e	ENST00000268835	5e	ENSE00001330251	chr17:18761492-18761574	83	KPRB_HUMAN	-	0	0	-	-
1.8	ENST00000268835	8	ENSE00001240575	chr17:18768782-18768877	96	KPRB_HUMAN	-	0	0	-	-
1.9	ENST00000268835	9	ENSE00002196815	chr17:18769115-18769265	151	KPRB_HUMAN	1-40	40	1	A:19-40	22
1.10b	ENST00000268835	10b	ENSE00001103100	chr17:18770595-18770647	53	KPRB_HUMAN	40-58	19	1	A:40-58	19
1.11	ENST00000268835	11	ENSE00000946774	chr17:18775896-18775962	67	KPRB_HUMAN	58-80	23	1	A:58-80	23
1.12	ENST00000268835	12	ENSE00000946775	chr17:18781011-18781183	173	KPRB_HUMAN	80-138	59	1	A:80-138 (gaps)	59
1.13b	ENST00000268835	13b	ENSE00002170587	chr17:18785881-18785996	116	KPRB_HUMAN	138-176	39	1	A:138-176	39
1.14	ENST00000268835	14	ENSE00002158948	chr17:18793135-18793190	56	KPRB_HUMAN	177-195	19	1	A:177-195	19
1.15b	ENST00000268835	15b	ENSE00002186709	chr17:18814416-18814564	149	KPRB_HUMAN	195-245	51	1	A:195-211	17
1.16	ENST00000268835	16	ENSE00002141164	chr17:18827227-18827297	71	KPRB_HUMAN	245-268	24	1	A:253-268	16
1.17b	ENST00000268835	17b	ENSE00000946780	chr17:18832124-18832270	147	KPRB_HUMAN	269-317	49	1	A:269-317	49
1.19a	ENST00000268835	19a	ENSE00001186912	chr17:18833853-18834580	728	KPRB_HUMAN	318-369	52	1	A:318-368	51

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:302
 aligned with KPRB_HUMAN | O60256 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:350
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368
           KPRB_HUMAN    19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLD 368
               SCOP domains d2ji4a1 A:19-178 automated matches                                                                                                                              d2ji4a2 A:179-368 automated match                                         es                                                                                                                   SCOP domains
               CATH domains 2ji4A01 A:19-164,A:340-360  [code=3.40.50.2020, no name defined]                                                                                  -----------------------------------------------                                         ---------------------------------------------------------------------------------------2ji4A01              -------- CATH domains
               Pfam domains --Pribosyltran_N-2ji4A01 A:21-138                                                                                       -------------------------------------------------------------------------                                         -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...hhhhhhhhhhhhhhhh.....eeeee.....eeeee.......eeeee.....hhhhhhhhhhhhhhhhhhh...eeeee.........-------.hhhhhhhhhhhhh...eeeee...hhhhhhhh...eeee.hhhhhhhhhhhhh.hhh.eeeee.hhhhhhhhhhhhhhh..eeeee.-----------------------------------------...ee......eeeeeeeee..hhhhhhhhhhhhhh...eeeeeeeee....hhhhhhhhh...eeeee....hhhhhhh...eeee.hhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ---------------------Exon 1.10b         ---------------------Exon 1.12  PDB: A:80-138 (gaps) UniProt: 80-138            --------------------------------------Exon 1.14          -------------------------------------------------Exon 1.16  PDB: A:253-26Exon 1.17b  PDB: A:269-317 UniProt: 269-317      Exon 1.19a  PDB: A:318-368 UniProt: 318-369         Transcript 1 (1)
           Transcript 1 (2) Exon 1.9  PDB: A:19-40-----------------Exon 1.11  PDB: A:58-80---------------------------------------------------------Exon 1.13b  PDB: A:138-176             ------------------Exon 1.15b  PDB: A:195-211 UniProt: 195-245        --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2ji4 A  19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQ-------SIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIH-----------------------------------------PITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLD 368
                                    28        38        48        58        68        78        88        98       108       | -     | 128       138       148       158       168       178       188       198       208  |      -         -         -         -    |  258       268       278       288       298       308       318       328       338       348       358       368
                                                                                                                           116     124                                                                                    211                                       253

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (9, 9)

Asymmetric Unit(hide GO term definitions)

Chain A (KPRB_HUMAN | O60256)

molecular function
	GO:0004857	enzyme inhibitor activity	Binds to and stops, prevents or reduces the activity of an enzyme.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0004749	ribose phosphate diphosphokinase activity	Catalysis of the reaction: D-ribose 5-phosphate + ATP = 5-phospho-alpha-D-ribose 1-diphosphate + AMP + 2 H(+).
biological process
	GO:0060348	bone development	The process whose specific outcome is the progression of bone over time, from its formation to the mature structure. Bone is the hard skeletal connective tissue consisting of both mineral and cellular components.
	GO:0043086	negative regulation of catalytic activity	Any process that stops or reduces the activity of an enzyme.
	GO:0006139	nucleobase-containing compound metabolic process	Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.
	GO:0009165	nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of nucleotides, any nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the glycose moiety; may be mono-, di- or triphosphate; this definition includes cyclic-nucleotides (nucleoside cyclic phosphates).
cellular component
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0002189	ribose phosphate diphosphokinase complex	A protein complex having ribose phosphate diphosphokinase activity.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:19 - Leu A:20	[ RasMol ]
		Leu A:367 - Asp A:368	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2ji4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	KPRB_HUMAN \| O60256
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description