Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  ORTHORHOMBIC STRUCTURE OF THE LDH DOMAIN OF HUMAN UBIQUITIN-CONJUGATING ENZYME E2-LIKE ISOFORM A
 
Authors :  J. R. Walker, G. V. Avvakumov, S. Xue, E. M. Newman, P. J. Finerty Jr. , C. Cole, W. Tempel, J. Weigelt, M. Sundstrom, C. H. Arrowsmith, A. M. Edwa A. Bochkarev, S. Dhe-Paganon
Date :  29 Aug 06  (Deposition) - 24 Oct 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Biol. Unit 2:  A,B  (1x)
Keywords :  L-Lactate Dehydrogenase, Oxidoreductase, Ubiquitin-Protein Ligase, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. V. Avvakumov, J. R. Walker, S. Xue, E. M. Newman, P. J. Finerty Jr. , C. Butler-Cole, W. Tempel, J. Weigelt, M. Sundstrom, C. H. Arrowsmith A. M. Edwards, A. Bochkarev, S. Dhe-Paganon
Structural Investigation Into The L-Lactate Dehydrogenase Domain Of Human Ubiquitin-Conjugating Enzyme E2-Like Isofor A
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - UBIQUITIN-CONJUGATING ENZYME E2-LIKE ISOFORM A
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28-LIC
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: L-LACTATE DEHYDROGENASE DOMAIN, RESIDUES 171-471
    Gene: UEVLD
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB
Biological Unit 2 (1x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric Unit (2, 11)
No.NameCountTypeFull Name
1GOL7Ligand/IonGLYCEROL
2SO44Ligand/IonSULFATE ION
Biological Unit 1 (2, 22)
No.NameCountTypeFull Name
1GOL14Ligand/IonGLYCEROL
2SO48Ligand/IonSULFATE ION
Biological Unit 2 (2, 11)
No.NameCountTypeFull Name
1GOL7Ligand/IonGLYCEROL
2SO44Ligand/IonSULFATE ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:282 , ALA A:336 , GLN A:337 , THR A:338 , SER A:339 , GLU A:362 , HOH A:497 , HOH A:549BINDING SITE FOR RESIDUE SO4 A 1
02AC2SOFTWAREHIS B:282 , ALA B:336 , GLN B:337 , THR B:338 , SER B:339 , GLU B:362 , HOH B:498BINDING SITE FOR RESIDUE SO4 B 2
03AC3SOFTWAREGOL B:8 , HIS B:282 , SER B:365 , SER B:368 , TYR B:418 , HOH B:494 , HOH B:507BINDING SITE FOR RESIDUE SO4 B 3
04AC4SOFTWAREGOL A:7 , HIS A:282 , VAL A:364 , SER A:365 , SER A:368 , TYR A:418 , HOH A:500 , HOH A:530 , HOH A:590BINDING SITE FOR RESIDUE SO4 A 4
05AC5SOFTWAREILE B:317 , GLY B:318 , CYS B:319 , ASN B:320 , LEU B:321 , ASP B:322 , GLN B:385 , SER B:393BINDING SITE FOR RESIDUE GOL B 5
06AC6SOFTWAREILE A:317 , GLY A:318 , CYS A:319 , ASN A:320 , LEU A:321 , ASP A:322 , GLN A:349 , GLN A:385 , SER A:393 , HOH A:544BINDING SITE FOR RESIDUE GOL A 6
07AC7SOFTWARESO4 A:4 , PRO A:278 , GLY A:281 , HIS A:282 , SER A:307 , THR A:367 , SER A:368 , GLN A:371 , LYS A:443 , HOH A:500BINDING SITE FOR RESIDUE GOL A 7
08AC8SOFTWARESO4 B:3 , PRO B:278 , GLY B:281 , HIS B:282 , SER B:307 , THR B:367 , SER B:368 , GLN B:371 , LYS B:443 , HOH B:494BINDING SITE FOR RESIDUE GOL B 8
09AC9SOFTWARELYS A:238 , ASP A:239 , LEU A:240 , SER A:241 , VAL A:333 , LEU A:334 , ARG A:375 , HOH A:529BINDING SITE FOR RESIDUE GOL A 9
10BC1SOFTWAREASP A:225 , ILE A:228 , PHE A:229 , HOH A:552 , LEU B:321 , GLN B:324 , LEU B:392 , SER B:393BINDING SITE FOR RESIDUE GOL A 10
11BC2SOFTWARETYR A:418 , VAL A:441 , ILE A:442 , LYS A:443 , THR A:444 , HOH A:517 , HOH A:540 , HOH A:606BINDING SITE FOR RESIDUE GOL A 11

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2I6T)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gln A:294 -Pro A:295
2Gln B:294 -Pro B:295

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2I6T)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2I6T)

(-) Exons   (7, 14)

Asymmetric Unit (7, 14)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003961971ENSE00001343027chr11:18610281-18610160122UEVLD_HUMAN1-14140--
1.2ENST000003961972ENSE00001150754chr11:18600355-1860027185UEVLD_HUMAN15-43290--
1.3ENST000003961973ENSE00001322441chr11:18596959-1859689466UEVLD_HUMAN43-65230--
1.4ENST000003961974ENSE00001106792chr11:18591924-18591761164UEVLD_HUMAN65-119550--
1.5ENST000003961975ENSE00001106800chr11:18588029-18587894136UEVLD_HUMAN120-165460--
1.6ENST000003961976ENSE00000997735chr11:18586557-18586439119UEVLD_HUMAN165-204402A:182-204
B:182-204
23
23
1.8ENST000003961978ENSE00000997734chr11:18579877-18579775103UEVLD_HUMAN205-239352A:205-239 (gaps)
B:205-239 (gaps)
35
35
1.9ENST000003961979ENSE00000997739chr11:18568597-18568427171UEVLD_HUMAN239-296582A:239-296 (gaps)
B:239-296 (gaps)
58
58
1.10ENST0000039619710ENSE00000997736chr11:18566343-18566170174UEVLD_HUMAN296-354592A:296-354
B:296-354
59
59
1.11ENST0000039619711ENSE00001210262chr11:18558016-1855795364UEVLD_HUMAN354-375222A:354-375
B:354-375
22
22
1.13ENST0000039619713ENSE00001524205chr11:18556000-18555877124UEVLD_HUMAN375-416422A:375-416
B:375-416
42
42
1.14ENST0000039619714ENSE00001790365chr11:18554034-18553245790UEVLD_HUMAN417-471552A:417-471 (gaps)
B:417-471 (gaps)
55
55

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:280
 aligned with UEVLD_HUMAN | Q8IX04 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:290
                                   191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471
          UEVLD_HUMAN   182 VNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL 471
               SCOP domains d2i6ta1 A:182-318 automated matches                                                                                                      d2i6ta2 A:319-471 automated matches                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..hhhhhhhhhhhhhhh...eeeee...-----hhhhhhhhh...eeee.hhhhhh...eeee....----.hhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhh....hhhh.eeee.......eeee.......hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh...eeeeeeee...........eeeeeeeee..eeeee.....-.hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6  PDB: A:182-20Exon 1.8  PDB: A:205-239 (gaps)    --------------------------------------------------------Exon 1.10  PDB: A:296-354 UniProt: 296-354                 --------------------Exon 1.13  PDB: A:375-416 UniProt: 375-416Exon 1.14  PDB: A:417-471 (gaps) UniProt: 417-471       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.9  PDB: A:239-296 (gaps) UniProt: 239-296          ---------------------------------------------------------Exon 1.11             ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2i6t A 182 VNKITVVGGGELGIACTLAISAKGIADRLVLLDLS-----ATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNS----QSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTL-EDTVTEKLQSSASSIHSLQQQLKL 471
                                   191       201       211    |    -|      231       241       251   |   261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441    | |451       461       471
                                                            216   222                              255  260                                                                                                                                                                                       446 |                       
                                                                                                                                                                                                                                                                                                    448                       

Chain B from PDB  Type:PROTEIN  Length:282
 aligned with UEVLD_HUMAN | Q8IX04 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:290
                                   191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471
          UEVLD_HUMAN   182 VNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL 471
               SCOP domains d2i6tb1 B:182-318 automated matches                                                                                                      d2i6tb2 B:319-471 automated matches                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..hhhhhhhhhhhhhh....eeeee.....--hhhhhhhhh....eeee.hhhhhh...eeee....----.hhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhh....hhhh.eeee.......eeee.......hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...eeeeeeee...........eeeeeeeee..eeeee......--.hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6  PDB: B:182-20Exon 1.8  PDB: B:205-239 (gaps)    --------------------------------------------------------Exon 1.10  PDB: B:296-354 UniProt: 296-354                 --------------------Exon 1.13  PDB: B:375-416 UniProt: 375-416Exon 1.14  PDB: B:417-471 (gaps) UniProt: 417-471       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.9  PDB: B:239-296 (gaps) UniProt: 239-296          ---------------------------------------------------------Exon 1.11             ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2i6t B 182 VNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEG--GATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNS----QSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLK--TVTEKLQSSASSIHSLQQQLKL 471
                                   191       201       211      |221       231       241       251   |   261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441     | 451       461       471
                                                              218  |                               255  260                                                                                                                                                                                        447  |                     
                                                                 221                                                                                                                                                                                                                                  450                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2I6T)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I6T)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (UEVLD_HUMAN | Q8IX04)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016616    oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0019752    carboxylic acid metabolic process    The chemical reactions and pathways involving carboxylic acids, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:294 - Pro A:295   [ RasMol ]  
    Gln B:294 - Pro B:295   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i6t
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UEVLD_HUMAN | Q8IX04
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  UEVLD_HUMAN | Q8IX04
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        UEVLD_HUMAN | Q8IX04: 3dl2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2I6T)