|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2HIP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2HIP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2HIP) |
PROSITE Motifs (1, 2)
Asymmetric/Biological Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2HIP) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:71 aligned with HIP1_HALHA | P04168 from UniProtKB/Swiss-Prot Length:71 Alignment length:71 10 20 30 40 50 60 70 HIP1_HALHA 1 EPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 71 SCOP domains d2hipa_ A: HIPIP (high potential iron protein) SCOP domains CATH domains 2hipA00 A:1-71 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: A:1-71 UniProt: 1-71 PROSITE Transcript ----------------------------------------------------------------------- Transcript 2hip A 1 EPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 71 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:71 aligned with HIP1_HALHA | P04168 from UniProtKB/Swiss-Prot Length:71 Alignment length:71 10 20 30 40 50 60 70 HIP1_HALHA 1 EPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 71 SCOP domains d2hipb_ B: HIPIP (high potential iron protein) SCOP domains CATH domains 2hipB00 B:1-71 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: B:1-71 UniProt: 1-71 PROSITE Transcript ----------------------------------------------------------------------- Transcript 2hip B 1 EPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 71 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2HIP) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (HIP1_HALHA | P04168)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|