Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  GLNK, A SIGNAL PROTEIN FROM E. COLI
 
Authors :  Y. Xu, E. Cheah, P. D. Carr, W. C. Van Heeswijk, H. V. Westerhoff, S. G. Va D. L. Ollis
Date :  14 Jul 98  (Deposition) - 23 Jul 99  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  A  (3x)
Keywords :  Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Xu, E. Cheah, P. D. Carr, W. C. Van Heeswijk, H. V. Westerhoff, S. G. Vasudevan, D. L. Ollis
Glnk, A Pii-Homologue: Structure Reveals Atp Binding Site And Indicates How The T-Loops May Be Involved In Molecular Recognition.
J. Mol. Biol. V. 282 149 1998
PubMed-ID: 9733647  |  Reference-DOI: 10.1006/JMBI.1998.1979

(-) Compounds

Molecule 1 - PROTEIN (NITROGEN REGULATORY PROTEIN)
    Chains: A
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Plasmid: PNV102
    Strain: RB9040

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A
Biological Unit 2 (3x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1ATP1Ligand/IonADENOSINE-5'-TRIPHOSPHATE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1ATP2Ligand/IonADENOSINE-5'-TRIPHOSPHATE
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1ATP3Ligand/IonADENOSINE-5'-TRIPHOSPHATE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:7 , GLY A:27 , LEU A:28 , THR A:29 , GLY A:35 , GLY A:37 , LYS A:58 , ASP A:62 , VAL A:63 , ALA A:64 , GLY A:87 , GLY A:89 , LYS A:90 , ARG A:101 , ARG A:103 , HOH A:203 , HOH A:232BINDING SITE FOR RESIDUE ATP A 200

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GNK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2GNK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GNK)

(-) PROSITE Motifs  (2, 2)

Asymmetric Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PII_GLNB_DOMPS51343 P-II protein family profile.GLNK_ECOLI1-112  1A:1-112
2PII_GLNB_CTERPS00638 P-II protein C-terminal region signature.GLNK_ECOLI83-96  1A:83-96
Biological Unit 1 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PII_GLNB_DOMPS51343 P-II protein family profile.GLNK_ECOLI1-112  2A:1-112
2PII_GLNB_CTERPS00638 P-II protein C-terminal region signature.GLNK_ECOLI83-96  2A:83-96
Biological Unit 2 (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PII_GLNB_DOMPS51343 P-II protein family profile.GLNK_ECOLI1-112  3A:1-112
2PII_GLNB_CTERPS00638 P-II protein C-terminal region signature.GLNK_ECOLI83-96  3A:83-96

(-) Exons   (0, 0)

(no "Exon" information available for 2GNK)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:95
 aligned with GLNK_ECOLI | P0AC55 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:112
                                    10        20        30        40        50        60        70        80        90       100       110  
           GLNK_ECOLI     1 MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL 112
               SCOP domains d2gnka_ A: PII-homolog GlnK                                                                                      SCOP domains
               CATH domains 2gnkA00 A:1-112  [code=3.30.70.120, n                 o name defined]                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.hhhhhhhhhhhhh......eeeeeee..-----------------.eeeeeeeeee.hhhhhhhhhhhhhhh........eeeeee............hhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) PII_GLNB_DOM  PDB: A:1-112 UniProt: 1-112                                                                        PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------PII_GLNB_CTER ---------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 2gnk A   1 MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFG-----------------FLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL 112
                                    10        20        30      |  -         -    |   60        70        80        90       100       110  
                                                               37                55
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GNK)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)
Chain A   (GLNK_ECOLI | P0AC55)
molecular function
    GO:0030234    enzyme regulator activity    Binds to and modulates the activity of an enzyme.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0045848    positive regulation of nitrogen utilization    Any process that activates or increases the frequency, rate or extent of nitrogen utilization.
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0006808    regulation of nitrogen utilization    Any process that modulates the frequency, rate or extent of nitrogen utilization.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ATP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gnk)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2gnk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GLNK_ECOLI | P0AC55
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GLNK_ECOLI | P0AC55
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GLNK_ECOLI | P0AC55: 1gnk 2ns1 2nuu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2GNK)