2NS1 - JenaLib

Asymmetric Unit (11, 11)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ILE A:331 , SER A:336 , LEU A:337 , GLU A:344 , MET A:348 , HOH A:737 , HOH A:755 , HOH A:778 , HOH A:893 , HOH A:900	BINDING SITE FOR RESIDUE BOG A 601
02	AC2	SOFTWARE	LYS A:375 , BOG A:604 , HOH A:1024	BINDING SITE FOR RESIDUE BOG A 602
03	AC3	SOFTWARE	TYR A:180 , LEU A:305 , LEU A:306 , BOG A:606 , BOG A:607 , HOH A:751 , HOH A:770 , HOH A:1041 , ASP B:71 , HOH B:238	BINDING SITE FOR RESIDUE BOG A 603
04	AC4	SOFTWARE	LEU A:181 , GLY A:367 , VAL A:368 , PHE A:371 , LYS A:375 , BOG A:602 , BOG A:606 , HOH A:852 , HOH A:895 , HOH A:939	BINDING SITE FOR RESIDUE BOG A 604
05	AC5	SOFTWARE	SER A:126 , HOH A:745 , HOH A:776 , HOH A:830 , HOH A:1020	BINDING SITE FOR RESIDUE BOG A 605
06	AC6	SOFTWARE	TYR A:180 , LEU A:306 , ARG A:307 , BOG A:603 , BOG A:604 , BOG A:607 , HOH A:752 , HOH A:939 , ASP B:71 , ASP B:75 , HOH B:236	BINDING SITE FOR RESIDUE BOG A 606
07	AC7	SOFTWARE	BOG A:603 , BOG A:606 , HOH A:963 , HOH A:1027 , ASP B:71 , ARG B:98 , HOH B:280	BINDING SITE FOR RESIDUE BOG A 607
08	AC8	SOFTWARE	GLU A:70 , GLY A:71 , PHE A:75 , GLY A:76 , THR A:137 , PRO A:142 , HOH A:888 , HOH A:985	BINDING SITE FOR RESIDUE BOG A 608
09	AC9	SOFTWARE	ILE B:7 , GLY B:27 , LEU B:28 , THR B:29 , GLY B:35 , PHE B:36 , ARG B:38 , GLN B:39 , LYS B:58 , ASP B:62 , VAL B:63 , ALA B:64 , GLY B:87 , ASP B:88 , GLY B:89 , LYS B:90 , ARG B:101 , ARG B:103 , HOH B:208 , HOH B:212 , HOH B:221 , HOH B:310 , HOH B:311	BINDING SITE FOR RESIDUE ADP B 200
10	BC1	SOFTWARE	GLN A:104 , TRP A:148 , PHE A:161 , SER A:219 , HOH A:766 , HOH A:798 , HOH A:804 , HOH A:805	BINDING SITE FOR RESIDUE TRS A 701
11	BC2	SOFTWARE	VAL A:147 , TRP A:148 , ALA A:154 , ALA A:158 , LEU A:159 , ASP A:160 , TYR A:278 , HOH A:766 , HOH A:803 , HOH A:899 , HOH A:970	BINDING SITE FOR RESIDUE TRS A 702

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 4)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:404
 aligned with AMTB_ECOLI | P69681 from UniProtKB/Swiss-Prot  Length:428

    Alignment length:404
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424    
           AMTB_ECOLI    25 AVADKADNAFMMICTALVLFMTIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLMLKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYIPIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLLGACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVHGVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLADLTVGLRVPEEQEREGLDVNSHGENAYNA 428
               SCOP domains d2ns1a_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains 2ns1A00 A:3-406 Ammonium transporter AmtB like domains                                                                                                                                                                                                                                                                                                                                                               CATH domains
               Pfam domains --------Ammonium_transp-2ns1A01 A:11-404                                                                                                                                                                                                                                                                                                                                                                          -- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhh......ee..eehhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh..........hhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------AMMONIUM_TRANSP           ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ns1 A   3 AVADKADNAFMMICTALVLFMTIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLMLKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYIPIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLLGACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVHGVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLADLTVGLRVPEEQEREGLDVNSHGENAYNA 406
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402

Chain B from PDB  Type:PROTEIN  Length:113
 aligned with GLNK_ECOLI | P0AC55 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:113
                             1                                                                                                               
                             |       9        19        29        39        49        59        69        79        89        99       109   
           GLNK_ECOLI     - -MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL 112
               SCOP domains -d2ns1b1 B:1-112 PII-homolog GlnK                                                                                 SCOP domains
               CATH domains 2ns1B00 B:0-112  [code=3.30.70.120, no name defined]                                                              CATH domains
               Pfam domains ----P-II-2ns1B01 B:4-105                                                                                  ------- Pfam domains
         Sec.struct. author .eeeeeeeehhhhhhhhhhhhhhh.....eeeeeee........eee..eee....eeeeeeeeeee..hhhhhhhhhhhhhh.......eeeeeee..........hhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -PII_GLNB_DOM  PDB: B:1-112 UniProt: 1-112                                                                        PROSITE (1)
                PROSITE (2) ----------------------------------------------PII_GL-------------------------------PII_GLNB_CTER ---------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 2ns1 B   0 SMKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEFSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL 112
                                     9        19        29        39        49        59        69        79        89        99       109

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (2, 2)

Gene Ontology (21, 21)

Asymmetric Unit(hide GO term definitions)

Chain A (AMTB_ECOLI | P69681)

molecular function
	GO:0008519	ammonium transmembrane transporter activity	Enables the transfer of ammonium from one side of a membrane to the other. Ammonium is the cation NH4+ which is formed from N2 by root-nodule bacteria in leguminous plants and is an excretory product in ammonotelic animals.
	GO:0015292	uniporter activity	Catalysis of the transport of a single molecular species across a membrane; transport is independent of the movement of any other molecular species.
biological process
	GO:0072488	ammonium transmembrane transport	The directed movement of ammonium across a membrane by means of some agent such as a transporter or pore. Ammonium is the cation NH4+.
	GO:0015696	ammonium transport	The directed movement of ammonium into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Ammonium is the cation NH4+ which is formed from N2 by root-nodule bacteria in leguminous plants and is an excretory product in ammonotelic animals.
	GO:0015670	carbon dioxide transport	The directed movement of carbon dioxide (CO2) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0019740	nitrogen utilization	A series of processes that forms an integrated mechanism by which a cell or an organism detects the depletion of primary nitrogen source, usually ammonia, and then activates genes to scavenge the last traces of the primary nitrogen source and to transport and metabolize alternative nitrogen sources. The utilization process begins when the cell or organism detects nitrogen levels, includes the activation of genes whose products detect, transport or metabolize nitrogen-containing substances, and ends when nitrogen is incorporated into the cell or organism's metabolism.
	GO:0015695	organic cation transport	The directed movement of organic cations into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Organic cations are atoms or small molecules with a positive charge which contain carbon in covalent linkage.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (GLNK_ECOLI | P0AC55)

molecular function
	GO:0030234	enzyme regulator activity	Binds to and modulates the activity of an enzyme.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0045848	positive regulation of nitrogen utilization	Any process that activates or increases the frequency, rate or extent of nitrogen utilization.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
	GO:0006808	regulation of nitrogen utilization	Any process that modulates the frequency, rate or extent of nitrogen utilization.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ADP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		BOG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TRS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ile A:25 - Pro A:26	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2ns1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AMTB_ECOLI \| P69681
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GLNK_ECOLI \| P0AC55
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 11)

Sites (11, 11)