|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric/Biological Unit (2, 5) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2G42) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2G42) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2G42) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2G42) |
Exons (0, 0)| (no "Exon" information available for 2G42) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:79 aligned with Q9WZF7_THEMA | Q9WZF7 from UniProtKB/TrEMBL Length:90 Alignment length:79 1 | 9 19 29 39 49 59 69 Q9WZF7_THEMA - -MNIDEIERKIDEAIEKEDYETLLSLLNKRKELMEGLPKDKLSEILEKDRKRLEIIEKRKTALFQEINVIREARSSLQK 78 SCOP domains d2g42a_ A: Hypothetical protein TM0693 SCOP domains CATH domains ------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------- Transcript 2g42 A 0 GmNIDEIERKIDEAIEKEDYETLLSLLNKRKELmEGLPKDKLSEILEKDRKRLEIIEKRKTALFQEINVIREARSSLQK 78 | 9 19 29 | 39 49 59 69 | 33-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:78 aligned with Q9WZF7_THEMA | Q9WZF7 from UniProtKB/TrEMBL Length:90 Alignment length:78 1 | 9 19 29 39 49 59 69 Q9WZF7_THEMA - -MNIDEIERKIDEAIEKEDYETLLSLLNKRKELMEGLPKDKLSEILEKDRKRLEIIEKRKTALFQEINVIREARSSLQ 77 SCOP domains d2g42b_ B: Hypothetical protein TM0693 SCOP domains CATH domains ------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 2g42 B 0 GmNIDEIERKIDEAIEKEDYETLLSLLNKRKELmEGLPKDKLSEILEKDRKRLEIIEKRKTALFQEINVIREARSSLQ 77 | 9 19 29 | 39 49 59 69 1-MSE 33-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2G42) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2G42) |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q9WZF7_THEMA | Q9WZF7)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|