![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 5) |
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 2FZT) |
(no "Cis Peptide Bond" information available for 2FZT) |
(no "SAP(SNP)/Variant" information available for 2FZT) |
(no "PROSITE Motif" information available for 2FZT) |
(no "Exon" information available for 2FZT) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:78 aligned with Q9WZF7_THEMA | Q9WZF7 from UniProtKB/TrEMBL Length:90 Alignment length:78 10 20 30 40 50 60 70 Q9WZF7_THEMA 1 MNIDEIERKIDEAIEKEDYETLLSLLNKRKELMEGLPKDKLSEILEKDRKRLEIIEKRKTALFQEINVIREARSSLQK 78 SCOP domains d2fzta1 A:1-78 Hypothetical protein TM0693 SCOP domains CATH domains ------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 2fzt A 1 mNIDEIERKIDEAIEKEDYETLLSLLNKRKELmEGLPKDKLSEILEKDRKRLEIIEKRKTALFQEINVIREARSSLQK 78 | 10 20 30 | 40 50 60 70 | 33-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:79 aligned with Q9WZF7_THEMA | Q9WZF7 from UniProtKB/TrEMBL Length:90 Alignment length:79 1 | 9 19 29 39 49 59 69 Q9WZF7_THEMA - -MNIDEIERKIDEAIEKEDYETLLSLLNKRKELMEGLPKDKLSEILEKDRKRLEIIEKRKTALFQEINVIREARSSLQK 78 SCOP domains d2fztb_ B: Hypothetical protein TM0693 SCOP domains CATH domains ------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------- Transcript 2fzt B 0 GmNIDEIERKIDEAIEKEDYETLLSLLNKRKELmEGLPKDKLSEILEKDRKRLEIIEKRKTALFQEINVIREARSSLQK 78 | 9 19 29 | 39 49 59 69 1-MSE 33-MSE
|
Asymmetric/Biological Unit |
(no "CATH Domain" information available for 2FZT) |
(no "Pfam Domain" information available for 2FZT) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q9WZF7_THEMA | Q9WZF7)
|
|
|
|
|
|
|