|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 15)| Asymmetric/Biological Unit (3, 15) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2G0I) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2G0I) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2G0I) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2G0I) |
Exons (0, 0)| (no "Exon" information available for 2G0I) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:111 aligned with Q8DUQ5_STRMU | Q8DUQ5 from UniProtKB/TrEMBL Length:111 Alignment length:112 1 | 9 19 29 39 49 59 69 79 89 99 109 Q8DUQ5_STRMU - -MIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTVSLQMDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ 111 SCOP domains -d2g0ia1 A:1-111 Hypoth etical protein Smu.848 SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 2g0i A 0 SmIQATFIRRKGILESVELTGHA-SGEYGFDIVCAAVSTLSmNLVNALEVLADCTVSLQmDEFDGGYmKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKImTQ 111 | 9 19 | | 29 39 | 49 59 |69 79 89 99 109 | 22 | 41-MSE 59-MSE 67-MSE 109-MSE 1-MSE 24 Chain B from PDB Type:PROTEIN Length:112 aligned with Q8DUQ5_STRMU | Q8DUQ5 from UniProtKB/TrEMBL Length:111 Alignment length:112 1 | 9 19 29 39 49 59 69 79 89 99 109 Q8DUQ5_STRMU - -MIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTVSLQMDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ 111 SCOP domains d2g0ib_ B: Hypothetical protein Smu.848 SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 2g0i B 0 SmIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSmNLVNALEVLADCTVSLQmDEFDGGYmKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKImTQ 111 | 9 19 29 39 | 49 59 |69 79 89 99 109 | 41-MSE 59-MSE 67-MSE 109-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2G0I) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2G0I) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2G0I)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|