3BFX - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN SULFOTRANSFERASE SULT1C1 IN COMPLEX WITH PAP

Authors :   A. Dong, L. Dombrovski, P. Loppnau, A. M. Edwards, C. H. Arrowsmith, J. Weigelt, M. Sundstrom, A. Bochkarev, A. N. Plotnikov, Structural Genomics Consortium (Sgc)

Date :   23 Nov 07 (Deposition) - 04 Dec 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Sulfotransferase, Pap, Structural Genomics, Psi, Protein Structure Initiative, Structural Genomics Consortium, Sgc, Alternative Splicing, Cytoplasm, Polymorphism (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Dombrovski, A. Dong, A. Bochkarev, A. N. Plotnikov
Crystal Structures Of Human Sulfotransferases Sult1B1 And Sult1C1 Complexed With The Cofactor Product Adenosine-3'-5'-Diphosphate (Pap).
Proteins V. 64 1091 2006
PubMed-ID: 16804942 | Reference-DOI: 10.1002/PROT.21048
(for further references see the PDB file header)

Molecule 1 - SULFOTRANSFERASE 1C2
	Chains	:	A, B
	EC Number	:	2.8.2.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET28
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	SULT1C2, SULT1C1
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SULFOTRANSFERASE 1C1, SULT1C#1, ST1C2, HUMSULTC2

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	A3P	2	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	A3P	2	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	A3P	-1	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:49 , ALA A:50 , GLY A:51 , THR A:52 , THR A:53 , TRP A:54 , ARG A:131 , SER A:139 , TYR A:194 , THR A:228 , SER A:229 , PHE A:230 , MET A:233 , MET A:257 , ARG A:258 , LYS A:259 , GLY A:260 , HOH A:4009 , HOH A:4011 , HOH A:4015 , HOH A:4019 , HOH A:4025 , HOH A:4058	BINDING SITE FOR RESIDUE A3P A 4000
2	AC2	SOFTWARE	HOH A:4017 , HOH A:4026 , HOH A:4042 , HOH A:4100 , HOH A:4120 , LYS B:49 , ALA B:50 , GLY B:51 , THR B:52 , THR B:53 , TRP B:54 , ARG B:131 , SER B:139 , TYR B:194 , THR B:228 , PHE B:230 , MET B:233 , PHE B:256 , MET B:257 , ARG B:258 , LYS B:259 , GLY B:260 , HOH B:348	BINDING SITE FOR RESIDUE A3P A 4001

(no "SS Bond" information available for 3BFX)

Asymmetric Unit

No.	Residues
1	Gln A:64	-	Asn A:65
2	Pro A:88	-	Pro A:89
3	Ser A:102	-	Pro A:103
4	Gln B:64	-	Asn B:65
5	Pro B:88	-	Pro B:89
6	Ser B:102	-	Pro B:103

Asymmetric Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021986	Y	128	H	ST1C2_HUMAN	Polymorphism	17036091	A/B	Y	128	H
2	UniProt	VAR_061888	R	282	T	ST1C2_HUMAN	Polymorphism	45515691	A/B	R	282	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021986	Y	128	H	ST1C2_HUMAN	Polymorphism	17036091	A	Y	128	H
2	UniProt	VAR_061888	R	282	T	ST1C2_HUMAN	Polymorphism	45515691	A	R	282	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021986	Y	128	H	ST1C2_HUMAN	Polymorphism	17036091	B	Y	128	H
2	UniProt	VAR_061888	R	282	T	ST1C2_HUMAN	Polymorphism	45515691	B	R	282	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3BFX)

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000251481	1a	ENSE00001269368	chr2:108905095-108905526	432	ST1C2_HUMAN	-	0	0	-	-
1.2a	ENST00000251481	2a	ENSE00000804415	chr2:108910103-108910274	172	ST1C2_HUMAN	1-51	51	2	A:12-51 B:12-51	40 40
1.3b	ENST00000251481	3b	ENSE00000772727	chr2:108910685-108910810	126	ST1C2_HUMAN	51-93	43	2	A:51-93 (gaps) B:51-93 (gaps)	43 43
1.5c	ENST00000251481	5c	ENSE00001269408	chr2:108917294-108917391	98	ST1C2_HUMAN	93-125	33	2	A:93-125 B:93-125	33 33
1.5f	ENST00000251481	5f	ENSE00001653740	chr2:108921030-108921156	127	ST1C2_HUMAN	126-168	43	2	A:126-168 B:126-168	43 43
1.6	ENST00000251481	6	ENSE00001744815	chr2:108921628-108921722	95	ST1C2_HUMAN	168-199	32	2	A:168-199 B:168-199	32 32
1.7	ENST00000251481	7	ENSE00001719044	chr2:108921871-108922051	181	ST1C2_HUMAN	200-260	61	2	A:200-260 (gaps) B:200-260 (gaps)	61 61
1.8d	ENST00000251481	8d	ENSE00001414539	chr2:108924808-108926371	1564	ST1C2_HUMAN	260-296	37	2	A:260-296 B:260-296	37 37

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:253
 aligned with ST1C2_HUMAN | O00338 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:285
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291     
          ST1C2_HUMAN    12 KLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL 296
               SCOP domains d3bfxa1 A:12-296 Sulfotransferase Sult1c2                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 3bfxA00 A:12-296 P-loop containing nucleotide triphosph             ate hydrolases                                                                                                                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeehhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhhh.-------------............hhhhhhhhh....eeee........hhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhh......hhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh-------------------........hhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------H---------------------------------------------------------------------------------------------------------------------------------------------------------T-------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:12-51 UniProt: 1-51   -----------------------------------------Exon 1.5c  PDB: A:93-125         Exon 1.5f  PDB: A:126-168 UniProt: 126-168 -------------------------------Exon 1.7  PDB: A:200-260 (gaps) UniProt: 200-260             ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.3b  PDB: A:51-93 (gaps)             --------------------------------------------------------------------------Exon 1.6  PDB: A:168-199        ------------------------------------------------------------Exon 1.8d  PDB: A:260-296             Transcript 1 (2)
                 3bfx A  12 KLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNG-------------HPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKEN-------------------FMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFSMEL 296
                                    21        31        41        51        61    |    -        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231    |    -         -    |  261       271       281       291     
                                                                                 66            80                                                                                                                                                         236                 256

Chain B from PDB  Type:PROTEIN  Length:248
 aligned with ST1C2_HUMAN | O00338 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:285
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291     
          ST1C2_HUMAN    12 KLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL 296
               SCOP domains d3bfxb_ B: automated matches                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 3bfxB00 B:12-296 P-loop containing nucleotide triphosph             ate hydrolases                                                                                                                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeehhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhhh.-------------............hhhhhhhhh....eeee.......hhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhh......hhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhhhhhhh...--hhhhhhhhhhh.....----------------------.......hhhhhh.hhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------H---------------------------------------------------------------------------------------------------------------------------------------------------------T-------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:12-51 UniProt: 1-51   -----------------------------------------Exon 1.5c  PDB: B:93-125         Exon 1.5f  PDB: B:126-168 UniProt: 126-168 -------------------------------Exon 1.7  PDB: B:200-260 (gaps) UniProt: 200-260             ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.3b  PDB: B:51-93 (gaps)             --------------------------------------------------------------------------Exon 1.6  PDB: B:168-199        ------------------------------------------------------------Exon 1.8d  PDB: B:260-296             Transcript 1 (2)
                 3bfx B  12 KLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNG-------------HPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKK--ETVLDKIVQETSFEKM----------------------FMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFSMEL 296
                                    21        31        41        51        61    |    -        81        91       101       111       121       131       141       151       161       171       181       191       201       211   |  |221       231 |       -         -    |  261       271       281       291     
                                                                                 66            80                                                                                                                                    215  |            233                    256                                        
                                                                                                                                                                                                                                        218

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

1a	3bfxB00	B:12-296
1b	3bfxA00	A:12-296

(no "Pfam Domain" information available for 3BFX)

Asymmetric Unit(hide GO term definitions)

Chain A,B (ST1C2_HUMAN | O00338)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0009308	amine metabolic process	The chemical reactions and pathways involving any organic compound that is weakly basic in character and contains an amino or a substituted amino group. Amines are called primary, secondary, or tertiary according to whether one, two, or three carbon atoms are attached to the nitrogen atom.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		A3P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gln A:64 - Asn A:65	[ RasMol ]
		Gln B:64 - Asn B:65	[ RasMol ]
		Pro A:88 - Pro A:89	[ RasMol ]
		Pro B:88 - Pro B:89	[ RasMol ]
		Ser A:102 - Pro A:103	[ RasMol ]
		Ser B:102 - Pro B:103	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3bfx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST1C2_HUMAN \| O00338
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ST1C2_HUMAN \| O00338
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 3BFX)

(no "Related Entries Specified in the PDB File" available for 3BFX)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (0, 0)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File